About   Help   FAQ
Antibody
Detail
Antibody
Name: anti-Six2 (11562-1-AP)
Host: rabbit
Type: Polyclonal
Class: IgG
Note: Antibody obtained from Proteintech (11562-1-AP). Affinity purified.
MGI Accession ID: MGI:6276025
Antigen
Species: human
Region covered: amino acids 1-291
Note: Ag2124 fusion protein: MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQF PHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELTEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLGSSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILNPMSANLVDLGS
Gene Six2  sine oculis-related homeobox 2
Expression Gene Expression Data (227 results)
References J:266599 Rabadi MM, et al., Dev Biol. 2018 Nov 1;443(1):78-91
J:173795 Hilliard S, et al., Dev Biol. 2011 May 15;353(2):354-66
J:207609 Hilliard SA, et al., Dev Biol. 2014 Mar 1;387(1):1-14
J:241850 Naiman N, et al., Dev Cell. 2017 May 22;41(4):349-365.e3
J:248902 De Tomasi L, et al., Am J Hum Genet. 2017 Nov 2;101(5):803-814
J:316149 Okello DO, et al., Front Physiol. 2017;8:955
J:263032 Magella B, et al., Dev Biol. 2018 Jun 15;438(2):84-93
J:280280 Rutledge EA, et al., Dev Biol. 2019 Oct 15;454(2):156-169
J:296647 Wanner N, et al., J Am Soc Nephrol. 2019 Jan;30(1):63-78
J:285711 Sweat YY, et al., Dev Biol. 2020 Feb 15;458(2):246-256
J:289404 Rutledge EA, et al., Dev Dyn. 2020 Jun;249(6):765-774
J:293793 Basta JM, et al., Dev Biol. 2020 Aug 15;464(2):176-187
J:326010 Kanda S, et al., J Am Soc Nephrol. 2020 Jan;31(1):139-147
J:312349 van Ineveld RL, et al., Dev Dyn. 2021 Nov;250(11):1568-1583
J:333283 Guan N, et al., Kidney Int. 2022 Jul;102(1):108-120
J:333035 Prahl LS, et al., Dev Cell. 2023 Jan 23;58(2):110-120.e5
J:343078 Diniz F, et al., Nat Commun. 2023 Nov 25;14(1):7733
J:348632 Huang B, et al., Cell Stem Cell. 2024 Apr 22;
J:371219 Shalaby O, et al., Am J Pathol. 2025 Sep;195(9):1643-1659

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support.
last database update
03/24/2026
MGI 6.24
The Jackson Laboratory