Reference
Figure
ID
|
J:28714
Ellis J, et al., Mech Dev. 1995 Aug;52(2-3):319-41
11
MGI:5467959
|
|||||||||
Image | ||||||||||
Caption | Coch, cochlea; V.G, trigeminal ganglion; BucC, buccal cavity; PPal, posterior palate. 9JKS4-4) isofomr 4; Cypher3s; 296-327:STPIEHAPVCTSQATSPLLPASAQSPAAASPI->RERFETERNSPRFAKLRNWHHGLSAQILNVKS Isoform 5; Q9JKS4-5) | |||||||||
Copyright | Reprinted with permission from Elsevier from 10.1016/0925-4773(95)00411-S Mech Dev 52: 319-41, Ellis J; Liu Q; Breitman M; Jenkins NA; Gilbert DJ; Copeland NG; Tempest HV; Warren S; Muir E; Schilling H; Fletcher FA; Ziegler SF; Rogers JH, Embryo brain kinase: a novel gene of the eph/elk receptor tyrosine kinase family. Copyright 1995 | |||||||||
Associated Assays |
|
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO) |
||
Citing These Resources Funding Information Warranty Disclaimer, Privacy Notice, Licensing, & Copyright Send questions and comments to User Support. |
last database update 05/07/2024 MGI 6.23 |
|
|