About   Help   FAQ
Antibody
Detail
Antibody
Name: anti-Pancortin
Host: rabbit
Type: Polyclonal
MGI Accession ID: MGI:7730801
Antigen
Name: Pancortin
Species: Not Specified
Region covered: Carboxy terminal side of the Pancortin B part: H-CTQRDLQYVEKMENQMKGLETKFKQVEESHKQHLARQFK- NH2
Note: conjugated with diphtheria toxoid
Gene Olfm1  olfactomedin 1
Expression Gene Expression Data (33 results)
References J:62796 Nagano T, et al., J Neurochem. 2000 Jul;75(1):1-8
J:104246 Ando K, et al., Neuroscience. 2005;133(4):947-57

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support.
last database update
01/06/2026
MGI 6.24
The Jackson Laboratory