About   Help   FAQ
Antibody
Detail
Antibody
Name: Anti-Msi2 (ab50829)
Host: rabbit
Type: Polyclonal
Class: IgG
Note: Antibody obtained from abcam.
MGI Accession ID: MGI:7663918
Antigen
Name: Msi2
Species: human
Region covered: amino terminus amino acids 37-86. Sequence: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASV DKVLGQPHHEL
Gene Msi2  musashi RNA-binding protein 2
Expression Gene Expression Data (17 results)
Reference J:210460 Sutherland JM, et al., Biol Reprod. 2014 May;90(5):92

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support.
last database update
01/06/2026
MGI 6.24
The Jackson Laboratory