About   Help   FAQ
Antibody
Detail
Antibody
Name: Anti-c-Jun antibody (ab31419)
Host: rabbit
Type: Polyclonal
Class: IgG
Note: Antibody obtained from abcam (ab31419).
MGI Accession ID: MGI:7545112
Antigen
Name: c-Jun
Species: human
Region covered: Synthetic peptide within amino acids 210-259 (HLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKR).
Gene Jun  jun proto-oncogene
Expression Gene Expression Data (8 results)
Reference J:314897 Xie Q, et al., J Biol Chem. 2016 Feb 19;291(8):3947-58
Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support. 		last database update
03/18/2025
MGI 6.24 		The Jackson Laboratory