About   Help   FAQ
Antibody
Detail
Antibody
Name: anti-L1CAM - C-terminal region (ARP63103_P050)
Host: rabbit
Type: Polyclonal
Note: Antibody obtained from Aviva Systems Biology.
MGI Accession ID: MGI:7382791
Antigen
Name: L1CAM
Species: human
Region covered: Synthetic peptide located within the following region: GDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGA
Gene L1cam  L1 cell adhesion molecule
Expression Gene Expression Data (11 results)
Reference J:322165 Cunningham JG, et al., Dev Dyn. 2022 Mar;251(3):459-480
Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support. 		last database update
03/25/2025
MGI 6.24 		The Jackson Laboratory