About   Help   FAQ
Antibody
Detail
Antibody
Name: anti-SSBP3
Host: rabbit
Type: Polyclonal
Class: IgG
Note: This antibody was obtained from abcam (ab83815).
MGI Accession ID: MGI:6382187
Antigen
Species: human
Region covered: internal sequence amino acids 319 - 368 (DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV)
Gene Ssbp3  single-stranded DNA binding protein 3
Expression Gene Expression Data (1 results)
Reference J:281142 Wade AK, et al., J Biol Chem. 2019 Aug 2;294(31):11728-11740

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support.
last database update
01/28/2026
MGI 6.24
The Jackson Laboratory