About   Help   FAQ
Antibody
Detail
Antibody
Name: ATOH7 Antibody (NBP1-88639)
Host: rabbit
Type: Polyclonal
Class: IgG
Note: This antibody was obtained from Novus Biologicals (NBP1-88639). Immunogen affinity purified.
MGI Accession ID: MGI:6194901
Antigen
Name: Atoh7
Species: human
Region covered: Recombinant Protein corresponding to 60 carboxyl terminal amino acids: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Gene Atoh7  atonal bHLH transcription factor 7
Expression Gene Expression Data (43 results)
References J:260417 Miesfeld JB, et al., Gene Expr Patterns. 2018 Jan;27:114-121
J:268318 Miesfeld JB, et al., Sci Rep. 2018 Jul 5;8(1):10195
J:278612 Miltner AM, et al., Int J Mol Sci. 2019 Jun 14;20(12):2903
J:309183 Gomes AL, et al., Front Cell Dev Biol. 2020;8:711
J:339296 Fries M, et al., Cell Rep. 2023 Aug 16;42(8):112985
J:372845 Napoli FR, et al., Eye Brain. 2024;16:115-131

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support.
last database update
01/06/2026
MGI 6.24
The Jackson Laboratory