Alicia Valenzuela Anna Anagnostopolous Christopher Mungall Eisuke Dohi Georgios V. Gkoutos Hiroshi Masuya Howard Dene Melissa Berry Michelle Knowlton Nicole Vasilevsky Paul Schofield Tatsuya Kushida Terue Takatsuki Toyofumi Fujiwara Carroll W. Goldsmith Cynthia L. Smith Janan T. Eppig Susan Bello The Mammalian Phenotype Ontology is being developed by Cynthia L. Smith, Susan M. Bello, Anna V. Anagnostopoulos, Carroll W. Goldsmith and Janan T. Eppig, as part of the Mouse Genome Database (MGD) Project, Mouse Genome Informatics (MGI), The Jackson Laboratory, Bar Harbor, ME. This file contains pre-coordinated phenotype terms, definitions and synonyms that can be used to describe mammalian phenotypes. The ontology is represented as a directed acyclic graph (DAG). It organizes phenotype terms into major biological system headers such as nervous system and respiratory system. This ontology is currently under development. Weekly updates are available at the Mouse Genome Informatics (MGI) ftp site (ftp://ftp.informatics.jax.org/pub/reports/index.html#pheno) as well as the OBO Foundry site (http://obofoundry.org/). Japanese labels of MP were created by the MP Japanese Translation Project (https://github.com/dbcls/MP_Japanese). Questions, comments and suggestions are welcome, and should be directed to pheno@jax.org, Susan.Bello@jax.org or to GitHub tracker (https://github.com/mgijax/mammalian-phenotype-ontology/issues) MGD is funded by NIH/NHGRI grant HG000330. English The Mammalian Phenotype Ontology MPheno.ontology The Mammalian Phenotype Ontology Copyright © 2007, 2008, 2011, 2012, 2015, 2024 by The Jackson Laboratory. The official definition, explaining the meaning of a class or property. Shall be Aristotelian, formalized and normalized. Can be augmented with colloquial definitions. definition definition An IRI or similar locator for a request or discussion of an ontology term. IAO:0000233 external term_tracker_item The 'tracker item' can associate a tracker with a specific ontology term. term tracker item term tracker item Ontology annotation property. Relates an ontology to a term that is a designated root term of the ontology. Display tools like OLS can use terms annotated with this property as the starting point for rendering the ontology class hierarchy. There can be more than one root. IAO:0000700 external has_ontology_root_term has ontology root term has ontology root term Use on obsolete terms, relating the term to another term that can be used as a substitute Add as annotation triples in the granting ontology term replaced by term replaced by terms for CvDC Terms in use by Europhenome Terms in use by IMPC Terms in use by IMPC Early Viability Group Terms in use by Mouse Genetics Project, Sanger Institute, Wellcome Trust Genome Campus http://purl.org/dc/elements/1.1/creator dc-creator creator http://purl.org/dc/elements/1.1/description dc-description description http://purl.org/dc/elements/1.1/title dc-title title http://purl.org/dc/terms/contributor dc-contributor contributor http://purl.org/dc/terms/date dcterms-date date http://purl.org/dc/terms/license dcterms-license license subset_property consider created by creation date has_alternative_id An alternative label for a class or property which has a more general meaning than the preferred name/primary label. https://github.com/information-artifact-ontology/ontology-metadata/issues/18 has broad synonym has_broad_synonym An annotation property that links an ontology entity or a statement to a prefixed identifier or URI. database_cross_reference has cross-reference An alternative label for a class or property which has the exact same meaning than the preferred name/primary label. https://github.com/information-artifact-ontology/ontology-metadata/issues/20 has exact synonym has_exact_synonym An alternative label for a class or property which has a more specific meaning than the preferred name/primary label. https://github.com/information-artifact-ontology/ontology-metadata/issues/19 has narrow synonym has_narrow_synonym has_obo_format_version has_obo_namespace An alternative label for a class or property that has been used synonymously with the primary term name, but the usage is not strictly correct. https://github.com/information-artifact-ontology/ontology-metadata/issues/21 has related synonym has_related_synonym id in_subset a core relation that holds between a part and its whole BFO:0000050 external part_of part of part of a core relation that holds between a whole and its part BFO:0000051 chebi_ontology external protein has_part has part has part has_part x is preceded by y if and only if the time point at which y ends is before or equivalent to the time point at which x starts. Formally: x preceded by y iff ω(y) <= α(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. BFO:0000062 preceded_by preceded by preceded by x precedes y if and only if the time point at which x ends is before or equivalent to the time point at which y starts. Formally: x precedes y iff ω(x) <= α(y), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. BFO:0000063 precedes precedes precedes b occurs_in c =def b is a process and c is a material entity or immaterial entity& there exists a spatiotemporal region r and b occupies_spatiotemporal_region r.& forall(t) if b exists_at t then c exists_at t & there exist spatial regions s and s’ where & b spatially_projects_onto s at t& c is occupies_spatial_region s’ at t& s is a proper_continuant_part_of s’ at t BFO:0000066 external occurs_in Paraphrase of definition: a relation between a process and an independent continuant, in which the process takes place entirely within the independent continuant occurs in occurs in [copied from inverse property 'occurs in'] b occurs_in c =def b is a process and c is a material entity or immaterial entity& there exists a spatiotemporal region r and b occupies_spatiotemporal_region r.& forall(t) if b exists_at t then c exists_at t & there exist spatial regions s and s’ where & b spatially_projects_onto s at t& c is occupies_spatial_region s’ at t& s is a proper_continuant_part_of s’ at t BFO:0000067 contains_process Paraphrase of definition: a relation between an independent continuant and a process, in which the process takes place entirely within the independent continuant contains process contains process x anterior to y iff x is further along the antero-posterior axis than y, towards the head. An antero-posterior axis is an axis that extends through an organism from head end to opposite end of body or tail. BSPO:0000096 rostral_to anterior_to anterior to x anterior to y iff x is further along the antero-posterior axis than y, towards the head. An antero-posterior axis is an axis that extends through an organism from head end to opposite end of body or tail. BSPO:cjm x distal to y iff x is further along the proximo-distal axis than y, towards the appendage tip. A proximo-distal axis extends from tip of an appendage (distal) to where it joins the body (proximal). BSPO:0000097 distal_to distal to x distal to y iff x is further along the proximo-distal axis than y, towards the appendage tip. A proximo-distal axis extends from tip of an appendage (distal) to where it joins the body (proximal). BSPO:cjm x dorsal to y iff x is further along the dorso-ventral axis than y, towards the back. A dorso-ventral axis is an axis that extends through an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:0000098 dorsal_to dorsal to x dorsal to y iff x is further along the dorso-ventral axis than y, towards the back. A dorso-ventral axis is an axis that extends through an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:cjm x posterior to y iff x is further along the antero-posterior axis than y, towards the body/tail. An antero-posterior axis is an axis that extends through an organism from head end to opposite end of body or tail. BSPO:0000099 posterior_to posterior to x posterior to y iff x is further along the antero-posterior axis than y, towards the body/tail. An antero-posterior axis is an axis that extends through an organism from head end to opposite end of body or tail. BSPO:cjm x proximal to y iff x is closer to the point of attachment with the body than y. BSPO:0000100 NCIT:C25236 proximal_to The elbow is proximal to the hand, but distal to the shoulder. proximal to x proximal to y iff x is closer to the point of attachment with the body than y. BSPO:cjm x ventral to y iff x is further along the dorso-ventral axis than y, towards the front. A dorso-ventral axis is an axis that extends through an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:0000102 ventral_to ventral to x ventral to y iff x is further along the dorso-ventral axis than y, towards the front. A dorso-ventral axis is an axis that extends through an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:cjm Further away from the surface of the organism. Thus, the muscular layer is deep to the skin, but superficial to the intestines. BSPO:0000107 deep_to deep to Further away from the surface of the organism. Thus, the muscular layer is deep to the skin, but superficial to the intestines. BSPO:cjm Near the outer surface of the organism. Thus, skin is superficial to the muscle layer. BSPO:0000108 superficial_to superficial to Near the outer surface of the organism. Thus, skin is superficial to the muscle layer. BSPO:cjm X in left side of Y <=> if Y is subdivided into two left and right portions, X is part of the left portion. BSPO:0000120 NCIT:C25229 in_left_side_of in left side of X in left side of Y <=> if Y is subdivided into two left and right portions, X is part of the left portion. BSPO:PATO_mtg_2009 X in right side of Y <=> if Y is subdivided into two left and right portions, X is part of the right portion. BSPO:0000121 NCIT:C25228 in_right_side_of in right side of X in right side of Y <=> if Y is subdivided into two left and right portions, X is part of the right portion. BSPO:PATO_mtg_2009 X posterior side of Y <=> if Y is subdivided into two anterior and posterior portions, X is part of the posterior portion. BSPO:0000122 in_posterior_side_of in posterior side of X posterior side of Y <=> if Y is subdivided into two anterior and posterior portions, X is part of the posterior portion. BSPO:PATO_mtg_2009 X anterior side of Y <=> if Y is subdivided into two anterior and posterior portions, X is part of the anterior portion. BSPO:0000123 in_anterior_side_of in anterior side of X anterior side of Y <=> if Y is subdivided into two anterior and posterior portions, X is part of the anterior portion. BSPO:PATO_mtg_2009 x in proximal side of y <=> if y is subdivided into two proximal and distal portions, y is part of the proximal portion. BSPO:0000124 in_proximal_side_of in proximal side of x in proximal side of y <=> if y is subdivided into two proximal and distal portions, y is part of the proximal portion. BSPO:PATO_mtg_2009 x in distal side of y <=> if y is subdivided into two proximal and distal portions, y is part of the distal portion. BSPO:0000125 in_distal_side_of in distal side of x in distal side of y <=> if y is subdivided into two proximal and distal portions, y is part of the distal portion. BSPO:PATO_mtg_2009 X in lateral side of Y <=> if X is in left side of Y or X is in right side of Y. X is often, but not always a paired structure BSPO:0000126 in_lateral_side_of in lateral side of X in lateral side of Y <=> if X is in left side of Y or X is in right side of Y. X is often, but not always a paired structure UBERON:cjm X superficial part of Y <=> if Y is subdivided into two superficial and deep portions, X is part of the superficial portion. BSPO:0001100 in_superficial_part_of in superficial part of X superficial part of Y <=> if Y is subdivided into two superficial and deep portions, X is part of the superficial portion. BSPO:cjm X superficial part of Y <=> if Y is subdivided into two superficial and deep portions, X is part of the deep portion. BSPO:0001101 in_deep_part_of in deep part of X superficial part of Y <=> if Y is subdivided into two superficial and deep portions, X is part of the deep portion. BSPO:cjm X proximalmost part of Y <=> X is in proximal side of Y and X is adjacent to the proximal boundary of Y BSPO:0001106 proximalmost_part_of proximalmost part of X proximalmost part of Y <=> X is in proximal side of Y and X is adjacent to the proximal boundary of Y https://orcid.org/0000-0002-6601-2165 x immediately deep to y iff x deep_to y and x is contiguous with y. BSPO:0001107 immediately_deep_to immediately deep to x immediately deep to y iff x deep_to y and x is contiguous with y. BSPO:curators X distalmost part of Y <=> X is in distal side of Y and X is adjacent to the distal boundary of Y BSPO:0001108 distalmost_part_of distalmost part of X distalmost part of Y <=> X is in distal side of Y and X is adjacent to the distal boundary of Y https://orcid.org/0000-0002-6601-2165 BSPO:0001113 preaxialmost_part_of preaxialmost part of BSPO:0001115 postaxialmost_part_of postaxialmost part of X intersects median plane of iff X crosses the midine plane of Y. BSPO:0005001 intersects_midsagittal_plane_of intersects midsagittal plane of x immediately superficial to y iff x superficial to y and x is contiguous with y. BSPO:0015014 immediately_superficial_to immediately superficial to x immediately superficial to y iff x superficial to y and x is contiguous with y. BSPO:curators X dorsal side of Y <=> if Y is subdivided into two dorsal and ventral portions, X is part of the dorsal portion. BSPO:0015101 in_dorsal_side_of in dorsal side of X dorsal side of Y <=> if Y is subdivided into two dorsal and ventral portions, X is part of the dorsal portion. BSPO:cjm X ventral side of Y <=> if Y is subdivided into two dorsal and ventral portions, X is part of the ventral portion. BSPO:0015102 in_ventral_side_of in ventral side of X ventral side of Y <=> if Y is subdivided into two dorsal and ventral portions, X is part of the ventral portion. BSPO:cjm has_not_completed lacks_part lacks_plasma_membrane_part GOREL:0002003 results_in_distribution_of results in distribution of results_in_distribution_of GOREL:0002004 results_in_fission_of results in fission of results_in_fission_of a relation between a specifically dependent continuant (the characteristic) and any other entity (the bearer), in which the characteristic depends on the bearer for its existence. Note that this relation was previously called "inheres in", but was changed to be called "characteristic of" because BFO2 uses "inheres in" in a more restricted fashion. This relation differs from BFO2:inheres_in in two respects: (1) it does not impose a range constraint, and thus it allows qualities of processes, as well as of information entities, whereas BFO2 restricts inheres_in to only apply to independent continuants (2) it is declared functional, i.e. something can only be a characteristic of one thing. characteristic of Inverse of characteristic_of has characteristic a relation between a continuant and a process, in which the continuant is somehow involved in the process RO:0000056 participates_in participates in participates in a relation between a process and a continuant, in which the continuant is somehow involved in the process has participant a relation between a function and an independent continuant (the bearer), in which the function specifically depends on the bearer for its existence This relation is modeled after the BFO relation of the same name which was in BFO2, but is used in a more restricted sense - specifically, we model this relation as functional (inherited from characteristic-of). Note that this relation is now removed from BFO2020. function of a relation between a quality and an independent continuant (the bearer), in which the quality specifically depends on the bearer for its existence This relation is modeled after the BFO relation of the same name which was in BFO2, but is used in a more restricted sense - specifically, we model this relation as functional (inherited from characteristic-of). Note that this relation is now removed from BFO2020. quality of a relation between a role and an independent continuant (the bearer), in which the role specifically depends on the bearer for its existence This relation is modeled after the BFO relation of the same name which was in BFO2, but is used in a more restricted sense - specifically, we model this relation as functional (inherited from characteristic-of). Note that this relation is now removed from BFO2020. role of a relation between an independent continuant (the bearer) and a function, in which the function specifically depends on the bearer for its existence has function a relation between an independent continuant (the bearer) and a quality, in which the quality specifically depends on the bearer for its existence RO:0000086 has_quality has quality has quality a relation between an independent continuant (the bearer) and a role, in which the role specifically depends on the bearer for its existence RO:0000087 chebi_ontology has_role has role has role a relation between an independent continuant (the bearer) and a disposition, in which the disposition specifically depends on the bearer for its existence has disposition inverse of has disposition This relation is modeled after the BFO relation of the same name which was in BFO2, but is used in a more restricted sense - specifically, we model this relation as functional (inherited from characteristic-of). Note that this relation is now removed from BFO2020. disposition of RO:0001000 protein derives_from derives_from a relation between two independent continuants, the location and the target, in which the target is entirely within the location RO:0001015 location_of location of location of a relation between two independent continuants, the target and the location, in which the target is entirely within the location RO:0001025 located_in located in located in a relation between a 2D immaterial entity (the boundary) and a material entity, in which the boundary delimits the material entity 2D boundary of a relation between a material entity and a 2D immaterial entity (the boundary), in which the boundary delimits the material entity RO:0002002 has_boundary has 2D boundary has 2D boundary relation between an anatomical structure and a neuron projection bundle that has synaptic terminals in the structure. RO:0002005 innervated_by innervated by innervated_by has synaptic terminal of X outer_layer_of Y iff: . X :continuant that bearer_of some PATO:laminar . X part_of Y . exists Z :surface . X has_boundary Z . Z boundary_of Y has_boundary: http://purl.obolibrary.org/obo/RO_0002002 boundary_of: http://purl.obolibrary.org/obo/RO_0002000 RO:0002007 bounding_layer_of A relationship that applies between a continuant and its outer, bounding layer. Examples include the relationship between a multicellular organism and its integument, between an animal cell and its plasma membrane, and between a membrane bound organelle and its outer/bounding membrane. bounding layer of bounding layer of A 'has regulatory component activity' B if A and B are GO molecular functions (GO_0003674), A has_component B and A is regulated by B. 2017-05-24T09:30:46Z has regulatory component activity A relationship that holds between a GO molecular function and a component of that molecular function that negatively regulates the activity of the whole. More formally, A 'has regulatory component activity' B iff :A and B are GO molecular functions (GO_0003674), A has_component B and A is negatively regulated by B. 2017-05-24T09:31:01Z By convention GO molecular functions are classified by their effector function. Internal regulatory functions are treated as components. For example, NMDA glutmate receptor activity is a cation channel activity with positive regulatory component 'glutamate binding' and negative regulatory components including 'zinc binding' and 'magnesium binding'. has negative regulatory component activity A relationship that holds between a GO molecular function and a component of that molecular function that positively regulates the activity of the whole. More formally, A 'has regulatory component activity' B iff :A and B are GO molecular functions (GO_0003674), A has_component B and A is positively regulated by B. 2017-05-24T09:31:17Z By convention GO molecular functions are classified by their effector function and internal regulatory functions are treated as components. So, for example calmodulin has a protein binding activity that has positive regulatory component activity calcium binding activity. Receptor tyrosine kinase activity is a tyrosine kinase activity that has positive regulatory component 'ligand binding'. has positive regulatory component activity 2017-05-24T09:44:33Z A 'has component activity' B if A is A and B are molecular functions (GO_0003674) and A has_component B. has component activity w 'has process component' p if p and w are processes, w 'has part' p and w is such that it can be directly disassembled into into n parts p, p2, p3, ..., pn, where these parts are of similar type. 2017-05-24T09:49:21Z has component process A relationship between a process and a barrier, where the process occurs in a region spanning the barrier. For cellular processes the barrier is typically a membrane. Examples include transport across a membrane and membrane depolarization. 2017-07-20T17:19:37Z occurs across 2017-09-17T13:52:24Z Process(P2) is directly regulated by process(P1) iff: P1 regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding regulates the kinase activity (P2) of protein B then P1 directly regulates P2. directly regulated by Process(P2) is directly regulated by process(P1) iff: P1 regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding regulates the kinase activity (P2) of protein B then P1 directly regulates P2. Process(P2) is directly negatively regulated by process(P1) iff: P1 negatively regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding negatively regulates the kinase activity (P2) of protein B then P2 directly negatively regulated by P1. 2017-09-17T13:52:38Z directly negatively regulated by Process(P2) is directly negatively regulated by process(P1) iff: P1 negatively regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding negatively regulates the kinase activity (P2) of protein B then P2 directly negatively regulated by P1. Process(P2) is directly postively regulated by process(P1) iff: P1 positively regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding positively regulates the kinase activity (P2) of protein B then P2 is directly postively regulated by P1. 2017-09-17T13:52:47Z directly positively regulated by Process(P2) is directly postively regulated by process(P1) iff: P1 positively regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding positively regulates the kinase activity (P2) of protein B then P2 is directly postively regulated by P1. A 'has effector activity' B if A and B are GO molecular functions (GO_0003674), A 'has component activity' B and B is the effector (output function) of B. Each compound function has only one effector activity. 2017-09-22T14:14:36Z This relation is designed for constructing compound molecular functions, typically in combination with one or more regulatory component activity relations. has effector activity A 'has effector activity' B if A and B are GO molecular functions (GO_0003674), A 'has component activity' B and B is the effector (output function) of B. Each compound function has only one effector activity. Primitive instance level timing relation between events before or simultaneous with x simultaneous with y iff ω(x) = ω(y) and ω(α ) = ω(α), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point and '=' indicates the same instance in time. RO:0002082 simultaneous_with t1 simultaneous_with t2 iff:= t1 before_or_simultaneous_with t2 and not (t1 before t2) simultaneous with simultaneous with X ends_after Y iff: end(Y) before_or_simultaneous_with end(X) ends after RO:0002087 immediately_preceded_by X immediately_preceded_by Y iff: end(X) simultaneous_with start(Y) immediately preceded by immediately preceded by X immediately_precedes_Y iff: end(X) simultaneous_with start(Y) immediately precedes Relation between a neuron and a material anatomical entity that its soma is part of. has soma location Relation between an anatomical structure (including cells) and a neuron that chemically synapses to it. RO:0002103 synapsed_by synapsed by synapsed by Holds between a cell c and a protein complex or protein p if and only if that cell has as part a plasma_membrane[GO:0005886], and that plasma membrane has p as part. has plasma membrane part Relation between a neuron and some structure (e.g.- a brain region) in which it receives (chemical) synaptic input. has postsynaptic terminal in Relation between a neuron and some structure (e.g.- a brain region) in which it receives (chemical) synaptic input. has presynaptic terminal in Relation between a neuron and an anatomical structure (including cells) that it chemically synapses to. N1 synapsed_to some N2 Expands to: N1 SubclassOf ( has_part some ( ‘pre-synaptic membrane ; GO:0042734’ that part_of some ( ‘synapse ; GO:0045202’ that has_part some ( ‘post-synaptic membrane ; GO:0045211’ that part_of some N2)))) synapsed to A general relation between a neuron and some structure in which it either chemically synapses to some target or in which it receives (chemical) synaptic input. has synaptic terminal in x overlaps y if and only if there exists some z such that x has part z and z part of y x overlaps y iff they have some part in common. RO:0002131 overlaps "(forall (x y) (iff (overlaps x y) (exists (z) (and (part of z x) (part of z y)))))" CLIF [] overlaps overlaps x overlaps y iff they have some part in common. BSPO:cjm Relation between a 'neuron projection bundle' and a region in which one or more of its component neuron projections either synapses to targets or receives synaptic input. T innervates some R Expands_to: T has_fasciculating_neuron_projection that synapse_in some R. RO:0002134 innervates innervates innervates X continuous_with Y if and only if X and Y share a fiat boundary. RO:0002150 continuous_with continuous with continuous with d derived_by_descent_from a if d is specified by some genetic program that is sequence-inherited-from a genetic program that specifies a. derived by descent from inverse of derived by descent from has derived by descendant two individual entities d1 and d2 stand in a shares_ancestor_with relation if and only if there exists some a such that d1 derived_by_descent_from a and d2 derived_by_descent_from a. RO:0002158 homologous_to VBO calls this homologous_to shares ancestor with RO:0002159 serially_homologous_to serially homologous to x only in taxon y if and only if x is in taxon y, and there is no other organism z such that y!=z a and x is in taxon z. only in taxon x is in taxon y if an only if y is an organism, and the relationship between x and y is one of: part of (reflexive), developmentally preceded by, derives from, secreted by, expressed. RO:0002162 life cycle stage of in_taxon Connects a biological entity to its taxon of origin. in taxon A is spatially_disjoint_from B if and only if they have no parts in common spatially disjoint from a is connected to b if and only if a and b are discrete structure, and there exists some connecting structure c, such that c connects a and b RO:0002170 connected_to connected to connected to c connects a if and only if there exist some b such that a and b are similar parts of the same system, and c connects b, specifically, c connects a with b. When one structure connects two others it unites some aspect of the function or role they play within the system. RO:0002176 connects connects connects a is attached to part of b if a is attached to b, or a is attached to some p, where p is part of b. RO:0002177 attaches_to_part_of attached to part of attached to part of Relation between an arterial structure and another structure, where the arterial structure acts as a conduit channeling fluid, substance or energy. RO:0002178 supplies supplies supplies Relation between an collecting structure and another structure, where the collecting structure acts as a conduit channeling fluid, substance or energy away from the other structure. RO:0002179 drains drains drains w 'has component' p if w 'has part' p and w is such that it can be directly disassembled into into n parts p, p2, p3, ..., pn, where these parts are of similar type. RO:0002180 protein has_component has component has component has_component x develops from y if and only if either (a) x directly develops from y or (b) there exists some z such that x directly develops from z and z develops from y RO:0002202 develops_from This is the transitive form of the develops from relation develops from develops from inverse of develops from RO:0002203 develops_into develops into develops into x expressed in y if and only if there is a gene expression process (GO:0010467) that occurs in y, and one of the following holds: (i) x is a gene, and x is transcribed into a transcript as part of the gene expression process (ii) x is a transcript, and the transcription of x is part of the gene expression process (iii) x is a mature gene product such as a protein, and x was translated or otherwise processes from a transcript that was transcribed as part of this gene expression process expressed in Candidate definition: x directly_develops from y if and only if there exists some developmental process (GO:0032502) p such that x and y both participate in p, and x is the output of p and y is the input of p, and a substantial portion of the matter of x comes from y, and the start of x is coincident with or after the end of y. RO:0002207 has developmental precursor directly_develops_from TODO - add child relations from DOS directly develops from directly develops from inverse of directly develops from directly develops into p regulates q iff p is causally upstream of q, the execution of p is not constant and varies according to specific conditions, and p influences the rate or magnitude of execution of q due to an effect either on some enabler of q or some enabler of a part of q. RO:0002211 external regulates regulates regulates regulates (processual) p negatively regulates q iff p regulates q, and p decreases the rate or magnitude of execution of q. RO:0002212 external negatively_regulates negatively regulates negatively regulates p positively regulates q iff p regulates q, and p increases the rate or magnitude of execution of q. RO:0002213 external positively_regulates positively regulates positively regulates A relation between a material entity (such as a cell) and a process, in which the material entity has the ability to carry out the process. RO:0002215 capable_of capable of capable of c stands in this relationship to p if and only if there exists some p' such that c is capable_of p', and p' is part_of p. RO:0002216 capable_of_part_of capable of part of capable of part of x surrounded_by y if and only if (1) x is adjacent to y and for every region r that is adjacent to x, r overlaps y (2) the shared boundary between x and y occupies the majority of the outermost boundary of x RO:0002219 surrounded_by surrounded by surrounded by x adjacent to y if and only if x and y share a boundary. RO:0002220 adjacent_to adjacent to adjacent to inverse of surrounded by RO:0002221 surrounds surrounds surrounds A relation that holds between two occurrents. This is a grouping relation that collects together all the Allen relations. temporally related to inverse of starts with RO:0002223 starts starts starts x starts with y if and only if x has part y and the time point at which x starts is equivalent to the time point at which y starts. Formally: α(y) = α(x) ∧ ω(y) < ω(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. RO:0002224 starts_with starts with starts with x develops from part of y if and only if there exists some z such that x develops from z and z is part of y RO:0002225 develops_from_part_of develops from part of develops from part of x develops_in y if x is located in y whilst x is developing RO:0002226 develops_in develops in develops in inverse of ends with RO:0002229 ends ends ends x ends with y if and only if x has part y and the time point at which x ends is equivalent to the time point at which y ends. Formally: α(y) > α(x) ∧ ω(y) = ω(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. RO:0002230 ends_with ends with ends with x 'has starts location' y if and only if there exists some process z such that x 'starts with' z and z 'occurs in' y has start location x 'has end location' y if and only if there exists some process z such that x 'ends with' z and z 'occurs in' y has end location p has input c iff: p is a process, c is a material entity, c is a participant in p, c is present at the start of p, and the state of c is modified during p. has input p has output c iff c is a participant in p, c is present at the end of p, and c is not present in the same state at the beginning of p. has output b connecting-branch-of s iff b is connected to s, and there exists some tree-like structure t such that the mereological sum of b plus s is either the same as t or a branching-part-of t. RO:0002252 connecting_branch_of connecting branch of inverse of connecting branch of has connecting branch x has developmental contribution from y iff x has some part z such that z develops from y RO:0002254 has_developmental_contribution_from has developmental contribution from has developmental contribution from inverse of has developmental contribution from developmentally contributes to t1 induced_by t2 if there is a process of developmental induction (GO:0031128) with t1 and t2 as interacting participants. t2 causes t1 to change its fate from a precursor material anatomical entity type T to T', where T' develops_from T RO:0002256 developmentally_induced_by developmentally induced by developmentally induced by Inverse of developmentally induced by developmentally induces Candidate definition: x developmentally related to y if and only if there exists some developmental process (GO:0032502) p such that x and y both participates in p, and x is the output of p and y is the input of p This relation groups together various other developmental relations. It is fairly generic, encompassing induction, developmental contribution and direct and transitive develops from developmentally preceded by c acts upstream of p if and only if c enables some f that is involved in p' and p' occurs chronologically before p, is not part of p, and affects the execution of p. c is a material entity and f, p, p' are processes. acts upstream of c acts upstream of or within p if c is enables f, and f is causally upstream of or within p. c is a material entity and p is an process. affects acts upstream of or within x developmentally replaces y if and only if there is some developmental process that causes x to move or to cease to exist, and for the site that was occupied by x to become occupied by y, where y either comes into existence in this site or moves to this site from somewhere else RO:0002285 developmentally_replaces developmentally replaces developmentally replaces Inverse of developmentally preceded by developmentally succeeded by part of developmental precursor of y expresses x if and only if there is a gene expression process (GO:0010467) that occurs in y, and one of the following holds: (i) x is a gene, and x is transcribed into a transcript as part of the gene expression process (ii) x is a transcript, and x was transcribed from a gene as part of the gene expression process (iii) x is a mature gene product (protein or RNA), and x was translated or otherwise processed from a transcript that was transcribed as part of the gene expression process. expresses p results in the developmental progression of s iff p is a developmental process and s is an anatomical entity and p causes s to undergo a change in state at some point along its natural developmental cycle (this cycle starts with its formation, through the mature structure, and ends with its loss). results in developmental progression of p 'results in development of' c if and only if p is a developmental process and p results in the state of c changing from its initial state as a primordium or anlage through its mature state and to its final state. results in development of results in formation of anatomical entity The relationship that links an entity with the process that results in the formation and shaping of that entity over time from an immature to a mature state. results in morphogenesis of The relationship that links an entity with a process that results in the progression of the entity over time that is independent of changes in it's shape and results in an end point state of that entity. results in maturation of p is causally upstream of, positive effect q iff p is casually upstream of q, and the execution of p is required for the execution of q. holds between x and y if and only if x is causally upstream of y and the progression of x increases the frequency, rate or extent of y causally upstream of, positive effect p is causally upstream of, negative effect q iff p is casually upstream of q, and the execution of p decreases the execution of q. causally upstream of, negative effect q characteristic of part of w if and only if there exists some p such that q inheres in p and p part of w. characteristic of part of The relationship that links a specified entity with the process that results in an unspecified entity acquiring the features and characteristics of the specified entity results in acquisition of features of A relationship that holds via some environmental process evolutionarily related to A relationship that is mediated in some way by the environment or environmental feature (ENVO:00002297) ecologically related to RO:0002322 confers_advantage_in confers advantage in confers advantage in A mereological relationship or a topological relationship mereotopologically related to A relationship that holds between entities participating in some developmental process (GO:0032502) developmentally related to c enables p iff c is capable of p and c acts to execute p. enables A grouping relationship for any relationship directly involving a function, or that holds because of a function of one of the related entities. RO:0002328 functionally_related_to functionally related to functionally related to this relation holds between c and p when c is part of some c', and c' is capable of p. part of structure that is capable of holds between two entities when some genome-level process such as gene expression is involved. This includes transcriptional, spliceosomal events. These relations can be used between either macromolecule entities (such as regions of nucleic acid) or between their abstract informational counterparts. RO:0002330 protein genomically_related_to genomically related to genomically_related_to c involved_in p if and only if c enables some process p', and p' is part of p involved in p regulates levels of c if p regulates some amount (PATO:0000070) of c regulates levels of inverse of enables enabled by inverse of regulates regulated by inverse of negatively regulates negatively regulated by inverse of positively regulates positively regulated by A relationship that holds via some process of localization related via localization to This relationship holds between p and l when p is a transport or localization process in which the outcome is to move some cargo c from some initial location l to some destination. has target start location This relationship holds between p and l when p is a transport or localization process in which the outcome is to move some cargo c from a an initial location to some destination l. has target end location Holds between p and l when p is a transportation or localization process and the outcome of this process is to move c from one location to another, and the route taken by c follows a path that is aligned_with l results in transport along Holds between p and m when p is a transportation or localization process and the outcome of this process is to move c from one location to another, and the route taken by c follows a path that crosses m. results in transport across results in growth of results in transport to from or in is member of is a mereological relation between a item and a collection. member of has member is a mereological relation between a collection and an item. RO:0002351 has_member has member has member inverse of has input RO:0002352 input_of input of input of inverse of has output RO:0002353 protein output_of output of output of output_of formed as result of has dendrite location a is attached to b if and only if a and b are discrete objects or object parts, and there are physical connections between a and b such that a force pulling a will move b, or a force pulling b will move a RO:0002371 attaches_to attached to attached to m has_muscle_origin s iff m is attached_to s, and it is the case that when m contracts, s does not move. The site of the origin tends to be more proximal and have greater mass than what the other end attaches to. RO:0002372 has_muscle_origin has muscle origin has muscle origin We need to import uberon muscle to create a stricter domain constraint m has_muscle_insertion s iff m is attaches_to s, and it is the case that when m contracts, s moves. Insertions are usually connections of muscle via tendon to bone. RO:0002373 has_muscle_insertion has muscle insertion has muscle insertion x has_fused_element y iff: there exists some z : x has_part z, z homologous_to y, and y is a distinct element, the boundary between x and z is largely fiat has fused element RO:0002374 has_fused_element A has_fused_element B does not imply that A has_part some B: rather than A has_part some B', where B' that has some evolutionary relationship to B. derived from ancestral fusion of derived from ancestral fusion of A relationship that holds between two material entities in a system of connected structures, where the branching relationship holds based on properties of the connecting network. in branching relationship with x tributary_of y if and only if x a channel for the flow of a substance into y, where y is larger than x. If x and y are hydrographic features, then y is the main stem of a river, or a lake or bay, but not the sea or ocean. If x and y are anatomical, then y is a vein. RO:0002376 tributary_of tributary of tributary of x spatially_coextensive_with y if and inly if x and y have the same location spatially coextensive with x is a branching part of y if and only if x is part of y and x is connected directly or indirectly to the main stem of y RO:0002380 branching_part_of branching part of branching part of x has developmental potential involving y iff x is capable of a developmental process with output y. y may be the successor of x, or may be a different structure in the vicinity (as for example in the case of developmental induction). has developmental potential involving x has potential to developmentrally contribute to y iff x developmentally contributes to y or x is capable of developmentally contributing to y RO:0002385 has_potential_to_developmentally_contribute_to has potential to developmentally contribute to has potential to developmentally contribute to x has potential to developmentally induce y iff x developmentally induces y or x is capable of developmentally inducing y has potential to developmentally induce x has the potential to develop into y iff x develops into y or if x is capable of developing into y RO:0002387 has_potential_to_develop_into This relation has a stronger meaning than merely indicating that X may develop into Y, in that the capability of developing into Y is always present, even if X does not always actually develop into Y. In particular, this means that if Y is restricted to a given taxon T, X is necessarily likewise restricted. has potential to develop into has potential to develop into x has potential to directly develop into y iff x directly develops into y or x is capable of directly developing into y has potential to directly develop into inverse of upstream of causally downstream of immediately causally downstream of p indirectly positively regulates q iff p is indirectly causally upstream of q and p positively regulates q. indirectly positively regulates p indirectly negatively regulates q iff p is indirectly causally upstream of q and p negatively regulates q. indirectly negatively regulates relation that links two events, processes, states, or objects such that one event, process, state, or object (a cause) contributes to the production of another event, process, state, or object (an effect) where the cause is partly or wholly responsible for the effect, and the effect is partly or wholly dependent on the cause. causally related to relation that links two events, processes, states, or objects such that one event, process, state, or object (a cause) contributes to the production of another event, process, state, or object (an effect) where the cause is partly or wholly responsible for the effect, and the effect is partly or wholly dependent on the cause. https://en.wikipedia.org/wiki/Causality p is causally upstream of q iff p is causally related to q, the end of p precedes the end of q, and p is not an occurrent part of q. causally upstream of p is immediately causally upstream of q iff p is causally upstream of q, and the end of p is coincident with the beginning of q. immediately causally upstream of p provides input for q iff p is immediately causally upstream of q, and there exists some c such that p has_output c and q has_input c. provides input for transitive form of directly_provides_input_for transitively provides input for p is 'causally upstream or within' q iff p is causally related to q, and the end of p precedes, or is coincident with, the end of q. affects causally upstream of or within inverse of causally upstream of or within causally downstream of or within c involved in regulation of p if c is involved in some p' and p' regulates some p involved in regulation of c involved in regulation of p if c is involved in some p' and p' positively regulates some p involved in positive regulation of c involved in regulation of p if c is involved in some p' and p' negatively regulates some p involved in negative regulation of c involved in or regulates p if and only if either (i) c is involved in p or (ii) c is involved in regulation of p involved in or involved in regulation of c executes activity in d if and only if c enables p and p occurs_in d. Assuming no action at a distance by gene products, if a gene product enables (is capable of) a process that occurs in some structure, it must have at least some part in that structure. enables activity in is active in c executes activity in d if and only if c enables p and p occurs_in d. Assuming no action at a distance by gene products, if a gene product enables (is capable of) a process that occurs in some structure, it must have at least some part in that structure. p contributes to morphology of w if and only if a change in the morphology of p entails a change in the morphology of w. Examples: every skull contributes to morphology of the head which it is a part of. Counter-example: nuclei do not generally contribute to the morphology of the cell they are part of, as they are buffered by cytoplasm. RO:0002433 contributes_to_morphology_of contributes to morphology of A relationship that holds between two entities in which the processes executed by the two entities are causally connected. in pairwise interaction with interacts with An interaction relationship in which the two partners are molecular entities that directly physically interact with each other for example via a stable binding interaction or a brief interaction during which one modifies the other. molecularly interacts with phosphorylates The entity A, immediately upstream of the entity B, has an activity that regulates an activity performed by B. For example, A and B may be gene products and binding of B by A regulates the kinase activity of B. A and B can be physically interacting but not necessarily. Immediately upstream means there are no intermediate entity between A and B. molecularly controls directly regulates activity of The entity A, immediately upstream of the entity B, has an activity that negatively regulates an activity performed by B. For example, A and B may be gene products and binding of B by A negatively regulates the kinase activity of B. molecularly decreases activity of directly negatively regulates activity of The entity A, immediately upstream of the entity B, has an activity that positively regulates an activity performed by B. For example, A and B may be gene products and binding of B by A positively regulates the kinase activity of B. molecularly increases activity of directly positively regulates activity of helper property (not for use in curation) x composed_primarily_of y if and only if more than half of the mass of x is made from y or units of the same type as y. RO:0002473 composed_primarily_of composed primarily of p has part that occurs in c if and only if there exists some p1, such that p has_part p1, and p1 occurs in c. has part that occurs in is kinase activity receives input from sends output to relation between physical entity and a process or stage x existence starts during y if and only if the time point at which x starts is after or equivalent to the time point at which y starts and before or equivalent to the time point at which y ends. Formally: x existence starts during y iff α(x) >= α(y) & α(x) <= ω(y). RO:0002488 existence_starts_during existence starts during x starts ends with y if and only if the time point at which x starts is equivalent to the time point at which y starts. Formally: x existence starts with y iff α(x) = α(y). RO:0002489 existence_starts_with existence starts with x existence overlaps y if and only if either (a) the start of x is part of y or (b) the end of x is part of y. Formally: x existence starts and ends during y iff (α(x) >= α(y) & α(x) <= ω(y)) OR (ω(x) <= ω(y) & ω(x) >= α(y)) The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence overlaps x exists during y if and only if: 1) the time point at which x begins to exist is after or equal to the time point at which y begins and 2) the time point at which x ceases to exist is before or equal to the point at which y ends. Formally: x existence starts and ends during y iff α(x) >= α(y) & α(x) <= ω(y) & ω(x) <= ω(y) & ω(x) >= α(y) RO:0002491 exists during existence_starts_and_ends_during The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence starts and ends during x existence ends during y if and only if the time point at which x ends is before or equivalent to the time point at which y ends and after or equivalent to the point at which y starts. Formally: x existence ends during y iff ω(x) <= ω(y) and ω(x) >= α(y). RO:0002492 existence_ends_during The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends during x existence ends with y if and only if the time point at which x ends is equivalent to the time point at which y ends. Formally: x existence ends with y iff ω(x) = ω(y). RO:0002493 existence_ends_with The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends with x transformation of y if x is the immediate transformation of y, or is linked to y through a chain of transformation relationships RO:0002494 transformation_of transformation of x immediate transformation of y iff x immediately succeeds y temporally at a time boundary t, and all of the matter present in x at t is present in y at t, and all the matter in y at t is present in x at t RO:0002495 immediate_transformation_of immediate transformation of x existence starts during or after y if and only if the time point at which x starts is after or equivalent to the time point at which y starts. Formally: x existence starts during or after y iff α (x) >= α (y). RO:0002496 existence_starts_during_or_after The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence starts during or after x existence ends during or before y if and only if the time point at which x ends is before or equivalent to the time point at which y ends. RO:0002497 existence_ends_during_or_before The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends during or before A relationship between a material entity and a process where the material entity has some causal role that influences the process causal agent in process p is causally related to q if and only if p or any part of p and q or any part of q are linked by a chain of events where each event pair is one where the execution of p influences the execution of q. p may be upstream, downstream, part of, or a container of q. causal relation between processes depends on q towards e2 if and only if q is a relational quality such that q inheres-in some e, and e != e2 and q is dependent on e2 towards p has intermediate c if and only if p has parts p1, p2 and p1 has output c, and p2 has input c has intermediate causal relation between entities A relation between a segment or subdivision of an organism and the maximal subdivision of material entities that provides structural support for that segment or subdivision. RO:0002551 has_skeleton has skeleton causally influenced by interaction relation helper property molecular interaction relation helper property Holds between p and c when p is locomotion process and the outcome of this process is the change of location of c results in movement of The entity or characteristic A is causally upstream of the entity or characteristic B, A having an effect on B. An entity corresponds to any biological type of entity as long as a mass is measurable. A characteristic corresponds to a particular specificity of an entity (e.g., phenotype, shape, size). causally influences A relation that holds between elements of a musculoskeletal system or its analogs. biomechanically related to m1 has_muscle_antagonist m2 iff m1 has_muscle_insertion s, m2 has_muscle_insection s, m1 acts in opposition to m2, and m2 is responsible for returning the structure to its initial position. RO:0002568 has_muscle_antagonist has muscle antagonist inverse of branching part of RO:0002569 has_branching_part has branching part x is a conduit for y iff y overlaps through the lumen_of of x, and y has parts on either side of the lumen of x. RO:0002570 conduit_for conduit for x lumen_of y iff x is the space or substance that is part of y and does not cross any of the inner membranes or boundaries of y that is maximal with respect to the volume of the convex hull. RO:0002571 lumen_of lumen of s is luminal space of x iff s is lumen_of x and s is an immaterial entity RO:0002572 luminal_space_of luminal space of A relation that holds between an attribute or a qualifier and another attribute. has modifier inverse of has skeleton RO:0002576 skeleton_of skeleton of p directly regulates q iff p is immediately causally upstream of q and p regulates q. directly regulates holds between x and y if and only if the time point at which x starts is equivalent to the time point at which y ends. Formally: iff α(x) = ω(y). existence starts at end of s 'has part structure that is capable of' p if and only if there exists some part x such that s 'has part' x and x 'capable of' p has part structure that is capable of p results in breakdown of c if and only if the execution of p leads to c no longer being present at the end of p results in breakdown of results in assembly of results in disassembly of p results in organization of c iff p results in the assembly, arrangement of constituent parts, or disassembly of c results in organization of A relationship that holds between a material entity and a process in which causality is involved, with either the material entity or some part of the material entity exerting some influence over the process, or the process influencing some aspect of the material entity. causal relation between material entity and a process Holds between c and p if and only if c is capable of some activity a, and a regulates p. capable of regulating Holds between c and p if and only if c is capable of some activity a, and a negatively regulates p. capable of negatively regulating Holds between c and p if and only if c is capable of some activity a, and a positively regulates p. capable of positively regulating Inverse of 'causal agent in process' process has causal agent p directly positively regulates q iff p is immediately causally upstream of q, and p positively regulates q. directly positively regulates p directly negatively regulates q iff p is immediately causally upstream of q, and p negatively regulates q. directly negatively regulates a produces b if some process that occurs_in a has_output b, where a and b are material entities. Examples: hybridoma cell line produces monoclonal antibody reagent; chondroblast produces avascular GAG-rich matrix. RO:0003000 produces Note that this definition doesn't quite distinguish the output of a transformation process from a production process, which is related to the identity/granularity issue. produces produces a produced_by b iff some process that occurs_in b has_output a. RO:0003001 produced_by produced by produced by p 'has primary input ot output' c iff either (a) p 'has primary input' c or (b) p 'has primary output' c. 2018-12-13T11:26:17Z has primary input or output p has primary output c if (a) p has output c and (b) the goal of process is to modify, produce, or transform c. 2018-12-13T11:26:32Z has primary output p has primary output c if (a) p has output c and (b) the goal of process is to modify, produce, or transform c. GOC:dph GOC:kva GOC:pt PMID:27812932 p has primary input c if (a) p has input c and (b) the goal of process is to modify, consume, or transform c. 2018-12-13T11:26:56Z has primary input p has primary input c if (a) p has input c and (b) the goal of process is to modify, consume, or transform c. GOC:dph GOC:kva GOC:pt PMID:27812932 Holds between an entity and an process P where the entity enables some larger compound process, and that larger process has-part P. 2018-01-25T23:20:13Z enables subfunction 2018-01-26T23:49:30Z acts upstream of or within, positive effect 2018-01-26T23:49:51Z acts upstream of or within, negative effect c 'acts upstream of, positive effect' p if c is enables f, and f is causally upstream of p, and the direction of f is positive 2018-01-26T23:53:14Z acts upstream of, positive effect c 'acts upstream of, negative effect' p if c is enables f, and f is causally upstream of p, and the direction of f is negative 2018-01-26T23:53:22Z acts upstream of, negative effect 2018-03-13T23:55:05Z causally upstream of or within, negative effect 2018-03-13T23:55:19Z causally upstream of or within, positive effect The entity A has an activity that regulates an activity of the entity B. For example, A and B are gene products where the catalytic activity of A regulates the kinase activity of B. regulates activity of p acts on population of c iff c' is a collection, has members of type c, and p has participant c 2020-06-08T17:21:33Z acts on population of 2021-02-26T07:28:29Z results in fusion of p is indirectly causally upstream of q iff p is causally upstream of q and there exists some process r such that p is causally upstream of r and r is causally upstream of q. 2022-09-26T06:07:17Z indirectly causally upstream of p indirectly regulates q iff p is indirectly causally upstream of q and p regulates q. 2022-09-26T06:08:01Z indirectly regulates A relation that applies between a cell type and a set of markers that can be used to uniquely identify that cell type. has marker gene combination has marker signature set has characterizing marker set s3 has_cross_section s3 if and only if : there exists some 2d plane that intersects the bearer of s3, and the impression of s3 upon that plane has shape quality s2. Example: a spherical object has the quality of being spherical, and the spherical quality has_cross_section round. has cross section s3 has_cross_section s3 if and only if : there exists some 2d plane that intersects the bearer of s3, and the impression of s3 upon that plane has shape quality s2. https://orcid.org/0000-0002-6601-2165 q1 reciprocal_of q2 if and only if : q1 and q2 are relational qualities and a phenotype e q1 e2 mutually implies a phenotype e2 q2 e. There are frequently two ways to state the same thing: we can say 'spermatocyte lacks asters' or 'asters absent from spermatocyte'. In this case the quality is 'lacking all parts of type' - it is a (relational) quality of the spermatocyte, and it is with respect to instances of 'aster'. One of the popular requirements of PATO is that it continue to support 'absent', so we need to relate statements which use this quality to the 'lacking all parts of type' quality. reciprocal of q1 reciprocal_of q2 if and only if : q1 and q2 are relational qualities and a phenotype e q1 e2 mutually implies a phenotype e2 q2 e. https://orcid.org/0000-0002-6601-2165 A relation between a cell and molecule or complex such that every instance of the cell has a high number of instances of that molecule expressed on the cell surface. has high plasma membrane amount A relation between a cell and molecule or complex such that every instance of the cell has a high number of instances of that molecule expressed on the cell surface. PMID:19243617 A relation between a cell and molecule or complex such that every instance of the cell has a low number of instances of that molecule expressed on the cell surface. has low plasma membrane amount A relation between a cell and molecule or complex such that every instance of the cell has a low number of instances of that molecule expressed on the cell surface. PMID:19243617 X device utilizes material Y means X and Y are material entities, and X is capable of some process P that has input Y. 2021-11-08T12:00:00Z utilizes device utilizes material chebi_ontology is_conjugate_base_of is conjugate base of chebi_ontology is_conjugate_acid_of is conjugate acid of chebi_ontology is_tautomer_of is tautomer of chebi_ontology is_substituent_group_from is substituent group from chebi_ontology has_functional_parent has functional parent chebi_ontology is_enantiomer_of is enantiomer of chebi_ontology has_parent_hydride has parent hydride A relationship that holds between a process and a characteristic in which process (P) regulates characteristic (C) iff: P results in the existence of C OR affects the intensity or magnitude of C. regulates characteristic A relationship that holds between a process and a characteristic in which process (P) positively regulates characteristic (C) iff: P results in an increase in the intensity or magnitude of C. positively regulates characteristic A relationship that holds between a process and a characteristic in which process (P) negatively regulates characteristic (C) iff: P results in a decrease in the intensity or magnitude of C. negatively regulates characteristic x vessel supplies blood to y if and only if x is a vessel that supplies blood directly or indirectly to an anatomical structure y. 2024-02-01T10:09:22Z RO:0020101 vessel_supplies_blood_to vessel supplies blood to x vessel drains blood from y if and only if x is a vessel that drains blood directly or indirectly from an anatomical structure y. 2024-02-01T10:09:41Z RO:0020102 vessel_drains_blood_from vessel drains blood from This property only applies to neurons 2024-10-23T14:34:52Z is neuron This property only applies to anatomical entities. 2024-10-29T09:55:07Z is anatomical entity A relation that holds between a polymer and its constituent monomers. P has_constituent_monomer c if and only if P has_component multiple instances of c and each instance of c is covalently attached to another instance of c. RO:0020337 protein has_constituent_monomer The constituent monomers need not be covalently attached in an end-to-end manner; that is, polymers with internal connections (e.g., polyubiquitin) can use this relation, as can circular polymers (e.g., plasmids) and multi-branched polymers (e.g., glycans). This relation, as non-transitive, allows one to indicate the number of instances of c. has_constituent_monomer A relation that holds between a polymer and its constituent monomers. P has_constituent_monomer c if and only if P has_component multiple instances of c and each instance of c is covalently attached to another instance of c. PRO:DAN p has anatomical participant c iff p has participant c, and c is an anatomical entity 2018-09-26T01:08:58Z results in changes to anatomical or cellular structure mouse_pathology.ontology part_of part of by_means has_participant See document https://docs.google.com/document/d/15iVMtMyYbQSlvUDgn2XUaDzpwkB0USZI for full definition. protein has_gene_template has_gene_template See document https://docs.google.com/document/d/15iVMtMyYbQSlvUDgn2XUaDzpwkB0USZI for full definition. PRO:DAN A negation of the has_part relation. protein lacks_part lacks_part A negation of the has_part relation. PRO:DAN x anteriorly_connected_to y iff the anterior part of x is connected to y. i.e. x connected_to y and x posterior_to y. anteriorly_connected_to anteriorly connected to x anteriorly_connected_to y iff the anterior part of x is connected to y. i.e. x connected_to y and x posterior_to y. http://purl.obolibrary.org/obo/uberon/docs/Connectivity-Design-Pattern carries channel_for channel for channels_from channels_from channels_into channels_into x distally_connected_to y iff the distal part of x is connected to y. i.e. x connected_to y and x proximal_to y. distally_connected_to distally connected to x distally_connected_to y iff the distal part of x is connected to y. i.e. x connected_to y and x proximal_to y. http://purl.obolibrary.org/obo/uberon/docs/Connectivity-Design-Pattern X extends_fibers into Y iff there exists some neuron (N) and N has_soma_location X and N 'has synaptic IO in region' some Y extends_fibers_into extends_fibers_into X extends_fibers into Y iff there exists some neuron (N) and N has_soma_location X and N 'has synaptic IO in region' some Y https://orcid.org/0000-0002-7073-9172 Relationship between a fluid and a material entity, where the fluid is the output of a realization of a filtration role that inheres in the material entity. filtered_through Relationship between a fluid and a filtration barrier, where the portion of fluid arises as a transformation of another portion of fluid on the other side of the barrier, with larger particles removed filtered through in_innermost_side_of in_innermost_side_of in_outermost_side_of in_outermost_side_of a indirectly_supplies s iff a has a branch and the branch supplies or indirectly supplies s. indirectly_supplies indirectly_supplies layer_part_of layer part of x posteriorly_connected_to y iff the posterior part of x is connected to y. i.e. x connected_to y and x anterior_to y. posteriorly_connected_to posteriorly connected to x posteriorly_connected_to y iff the posterior part of x is connected to y. i.e. x connected_to y and x anterior_to y. http://purl.obolibrary.org/obo/uberon/docs/Connectivity-Design-Pattern protects protects x proximally_connected_to y iff the proximal part of x is connected to y. i.e. x connected_to y and x distal_to y. proximally_connected_to proximally connected to x proximally_connected_to y iff the proximal part of x is connected to y. i.e. x connected_to y and x distal_to y. http://purl.obolibrary.org/obo/uberon/docs/Connectivity-Design-Pattern sexually_homologous_to sexually_homologous_to c site_of p if c is the bearer of a disposition that is realized by a process that has p as part. capable_of_has_part site_of site_of subdivision_of placeholder relation. X = 'subdivision of A' and subdivision_of some B means that X is the mereological sum of A and B subdivision of transitively_anteriorly_connected_to transitively anteriorly connected to transitively_distally_connected_to transitively distally connected to transitively_proximally_connected_to transitively proximally connected to trunk_part_of trunk_part_of entity An entity that exists in full at any time in which it exists at all, persists through time while maintaining its identity and has no temporal parts. continuant An entity that has temporal parts and that happens, unfolds or develops through time. occurrent b is an independent continuant = Def. b is a continuant which is such that there is no c and no t such that b s-depends_on c at t. (axiom label in BFO2 Reference: [017-002]) A continuant that is a bearer of quality and realizable entity entities, in which other entities inhere and which itself cannot inhere in anything. independent continuant spatial region p is a process = Def. p is an occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t. (axiom label in BFO2 Reference: [083-003]) An occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t. process disposition A specifically dependent continuant that inheres in continuant entities and are not exhibited in full at every time in which it inheres in an entity or group of entities. The exhibition or actualization of a realizable entity is a particular manifestation, functioning or process that occurs under certain circumstances. realizable entity quality b is a specifically dependent continuant = Def. b is a continuant & there is some independent continuant c which is not a spatial region and which is such that b s-depends_on c at every time t during the course of b’s existence. (axiom label in BFO2 Reference: [050-003]) A continuant that inheres in or is borne by other entities. Every instance of A requires some specific instance of B which must always be the same. specifically dependent continuant A realizable entity the manifestation of which brings about some result or end that is not essential to a continuant in virtue of the kind of thing that it is but that can be served or participated in by that kind of continuant in some kinds of natural, social or institutional contexts. role generically dependent continuant function An independent continuant that is spatially extended whose identity is independent of that of other entities and can be maintained through time. material entity immaterial entity Biological entity that is either an individual member of a biological species or constitutes the structural organization of an individual member of a biological species. CARO:0000000 anatomical entity Biological entity that is either an individual member of a biological species or constitutes the structural organization of an individual member of a biological species. CARO:MAH Elementary particle not affected by the strong force having a spin 1/2, a negative elementary charge and a rest mass of 0.000548579903(13) u, or 0.51099906(15) MeV. Elementary particle not affected by the strong force having a spin ½, a negative elementary charge and a rest mass of 0.000548579903(13) u, or 0.51099906(15) MeV. KEGG:C05359 Wikipedia:Electron chebi_ontology Elektron beta beta(-) beta-particle e e(-) e- electron negatron CHEBI:10545 electron Elektron ChEBI Elektron chebi beta IUPAC beta iupac beta(-) ChEBI beta(-) chebi beta-particle IUPAC beta-particle iupac e IUPAC e iupac e(-) UniProt e(-) uniprot_ft e- KEGG_COMPOUND e- kegg.compound electron chebi kegg.compound negatron IUPAC negatron iupac The conjugate base of γ-amino-β-hydroxybutyric acid arising from deprotonation of the carboxy group. chebi_ontology 4-Amino-3-hydroxybutanoate CHEBI:11955 4-amino-3-hydroxybutanoate 4-Amino-3-hydroxybutanoate kegg.compound Any member of a group of fat-soluble retinoids produced via metabolism of provitamin A carotenoids that exhibit biological activity against vitamin A deficiency. Vitamin A is involved in immune function, vision, reproduction, and cellular communication. chebi_ontology vitamin A vitamer vitamin A vitamers vitamin-A vitamins A CHEBI:12777 vitamin A vitamin A vitamer chebi vitamin A vitamers chebi vitamin-A chebi vitamins A chebi Any steroid substituted by a formyl group. chebi_ontology steroid aldehydes CHEBI:131565 steroid aldehyde steroid aldehydes ChEBI steroid aldehydes chebi Any bacterial metabolite produced during a metabolic reaction in <em>Mycoplasma genitalium</em>. Any bacterial metabolite produced during a metabolic reaction in Mycoplasma genitalium. chebi_ontology Mycoplasma genitalium metabolites CHEBI:131604 Mycoplasma genitalium metabolite Mycoplasma genitalium metabolites ChEBI Mycoplasma genitalium metabolites chebi A steroid compound with a structure based on a 27-carbon (cholestane) skeleton. chebi_ontology C27-steroids CHEBI:131619 C27-steroid C27-steroids chebi A steroid compound with a structure based on a 19-carbon (androstane) skeleton. chebi_ontology C19-steroids CHEBI:131621 C19-steroid C19-steroids ChEBI C19-steroids chebi A class of carbonyl compound encompassing dicarboxylic acids and any derivatives obtained by substitution of either one or both of the carboxy hydrogens. chebi_ontology dicarboxylic acids and derivatives CHEBI:131927 dicarboxylic acids and O-substituted derivatives dicarboxylic acids and derivatives ChEBI dicarboxylic acids and derivatives chebi A carbohydrate acid derivative anion obtained by deprotonation of the carboxy groups of hyaluronic acid; major species at pH 7.3. chebi_ontology hyaluronan hyaluronate polyanion CHEBI:132153 hyaluronate hyaluronan UniProt hyaluronan uniprot_ft hyaluronate polyanion ChEBI hyaluronate polyanion chebi A citrate anion obtained by deprotonation of the three carboxy groups as well as the hydroxy group of citric acid. chebi_ontology 2-oxido-1,2,3-propanetricarboxylate citric acid tetraanion CHEBI:132362 citrate(4-) 2-oxido-1,2,3-propanetricarboxylate chebi citric acid tetraanion chebi Any polyunsaturated fatty acid containing 20 carbons and 4 double bonds. chebi_ontology FA 20:4 free fatty acid 20:4 CHEBI:132539 fatty acid 20:4 FA 20:4 chebi free fatty acid 20:4 chebi A reagent that lightens or whitens a substrate through chemical reaction. Bleaching reactions usually involve oxidative or reductive processes that degrade colour systems. Bleaching can occur by destroying one or more of the double bonds in the conjugated chain, by cleaving the conjugated chain, or by oxidation of one of the other moieties in the conjugated chain. Their reactivity results in many bleaches having strong bactericidal, disinfecting, and sterilising properties. chebi_ontology CHEBI:132717 bleaching agent A dicarboxylic acid anion obtained by deprotonation of at least one of the carboxy groups of ethylmalonic acid. chebi_ontology ethylmalonate anion ethylmalonic acid anion CHEBI:132938 ethylmalonate ethylmalonate anion chebi ethylmalonic acid anion chebi A dicarboxylic acid dianion resulting from the removal of a proton from both of the carboxylic acid groups of ethylmalonic acid. chebi_ontology CHEBI:132939 ethylmalonate(2-) chebi_ontology aspartate anion aspartic acid anion CHEBI:132943 aspartate aspartate anion chebi aspartic acid anion chebi A dicarboxylic acid anion obtained by deprotonation of at least one of the carboxy groups of oxalic acid. chebi_ontology ethanedioic acid anion ethanedioic acid anions oxalate anion oxalate anions oxalates oxalic acid anion oxalic acid anions CHEBI:132952 oxalate ethanedioic acid anion chebi ethanedioic acid anions chebi oxalate anion chebi oxalate anions chebi oxalates chebi oxalic acid anion chebi oxalic acid anions chebi A peptide cation obtained by deprotonation of the carboxy group and protonation of the amino and guanidino groups of bradykinin; major species at pH 7.3. chebi_ontology bradykinin CHEBI:132988 bradykinin(2+) bradykinin uniprot_ft A carboxylic acid dianion obtained by deprotonation of both carboxy groups of any dicarboxylic acid that contains no carbon-carbon double bonds. chebi_ontology a saturated dicarboxylic acid CHEBI:133291 saturated dicarboxylic acid dianion(2-) a saturated dicarboxylic acid uniprot_ft A dicarboxylic acid dianion obtained by deprotonation of both carboxy groups of any oxo dicarboxylic acid. oxo dicarboxylic acid dianions CHEBI:133294 oxo dicarboxylic acid dianion oxo dicarboxylic acid dianions ChEBI A tricarboxylic acid anion obtained by deprotonation of at least one of the carboxy groups of citric acid. chebi_ontology citrate citrate anions CHEBI:133748 citrate anion citrate chebi citrate anions chebi Any polyunsaturated fatty acid anion carrying one or more hydroperoxy substituents. chebi_ontology a hydroperoxy polyunsaturated fatty acid hydroperoxy polyunsaturated fatty acid anions hydroperoxy-polyunsaturated fatty acid anion hydroperoxy-polyunsaturated fatty acid anions CHEBI:134019 hydroperoxy polyunsaturated fatty acid anion a hydroperoxy polyunsaturated fatty acid uniprot_ft hydroperoxy polyunsaturated fatty acid anions chebi hydroperoxy-polyunsaturated fatty acid anion chebi hydroperoxy-polyunsaturated fatty acid anions chebi A <em>N</em>-(long-chain-acyl)ethanolamine in which the acyl group contains 20 carbons and 4 double bonds. chebi_ontology NAE 20:4 CHEBI:134161 N-acylethanolamine 20:4 NAE 20:4 chebi Any organic compound having an initial boiling point less than or equal to 250 degreeC (482 degreeF) measured at a standard atmospheric pressure of 101.3 kPa. Any organic compound having an initial boiling point less than or equal to 250 °C (482 °F) measured at a standard atmospheric pressure of 101.3 kPa. Wikipedia:Volatile_organic_compound chebi_ontology VOC VOCs volatile organic compounds CHEBI:134179 volatile organic compound VOC ChEBI VOC chebi VOCs ChEBI VOCs chebi volatile organic compounds ChEBI volatile organic compounds chebi An alkanesulfonate in which the carbon at position 1 is attached to R, which can represent hydrogens, a carbon chain, or other groups. CHEBI:22318 chebi_ontology alkanesulfonate oxoanions alkanesulfonates an alkanesulfonate CHEBI:134249 alkanesulfonate oxoanion alkanesulfonate oxoanions chebi alkanesulfonates chebi an alkanesulfonate uniprot_ft An alcohol where the hydroxy group is attached to a saturated carbon atom adjacent to a double bond (R groups may be H, organyl, etc.). chebi_ontology allylic alcohols CHEBI:134361 allylic alcohol allylic alcohols chebi An <em>N</em>-oxide where there are three organic groups bonded to the nitrogen atom. chebi_ontology tertiary amine oxides CHEBI:134363 tertiary amine oxide tertiary amine oxides chebi An allylic alcohol in which the carbon atom that links the double bond to the hydroxy group is also attached to two hydrogens. chebi_ontology primary allylic alcohols CHEBI:134394 primary allylic alcohol primary allylic alcohols chebi An organic cation that is the conjugate acid of oxycodone, obtained by protonation of the tertiary amino group of oxycodone. chebi_ontology oxycodone cation CHEBI:134686 oxycodone(1+) oxycodone cation chebi A 3-oxo steroid that has α configuration at position 5. CHEBI:1622 CHEBI:20150 chebi_ontology 3-oxo 5alpha- steroid 3-oxo 5alpha- steroids 3-oxo 5alpha-steroids a 3-oxo-5-alpha-steroid CHEBI:13601 3-oxo-5alpha-steroid 3-oxo 5alpha- steroid chebi 3-oxo 5alpha- steroids chebi 3-oxo 5alpha-steroids chebi a 3-oxo-5-alpha-steroid uniprot_ft An organic group derived from any 3-oxo-Delta(4)-steroid. An organic group derived from any 3-oxo-Δ<small>^4</small>-steroid. chebi_ontology a 3-oxo-Delta4-steroid group CHEBI:136849 3-oxo-Delta(4)-steroid group a 3-oxo-Delta4-steroid group UniProt a 3-oxo-Delta4-steroid group uniprot_ft A compound that, on administration, undergoes conversion by biochemical (enzymatic), chemical (possibly following an enzymatic step), or physical (e.g. photochemical) activation processes before becoming the active agent for which it is a pro-agent. chebi_ontology pro-agents proagent proagents CHEBI:136859 pro-agent pro-agents chebi proagent chebi proagents chebi Any steroid that has beta-configuration at position 5. 5beta steroids 5beta-steroid 5beta-steroids CHEBI:136889 5beta steroid 5beta steroids ChEBI 5beta-steroid ChEBI 5beta-steroids ChEBI An organic cation obtained by protonation of the amino group of any tertiary amino compound. chebi_ontology a tertiary amine tertiary amine(1+) tertiary ammonium ions CHEBI:137982 tertiary ammonium ion a tertiary amine uniprot_ft tertiary amine(1+) chebi tertiary ammonium ions chebi A quaternary ammonium ion obtained by methylation of any tertiary amine chebi_ontology a methylated tertiary amine CHEBI:137983 methylated tertiary amine a methylated tertiary amine uniprot_ft A Bronsted acid derived from one or more inorganic compounds. Inorganic acids (also known as mineral acids) form hydrons and conjugate base ions when dissolved in water. A Brønsted acid derived from one or more inorganic compounds. Inorganic acids (also known as mineral acids) form hydrons and conjugate base ions when dissolved in water. Wikipedia:Mineral_acid chebi_ontology inorganic acids mineral acid mineral acids CHEBI:138103 inorganic acid inorganic acids ChEBI inorganic acids chebi mineral acid ChEBI mineral acid chebi mineral acids ChEBI mineral acids chebi Any member of a group of hydroxy steroids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration, while in lower vertebrates, some bile acids, known as allo-bile acids, have 5alpha-configuration. CHEBI:138366 bile acids An apoprotein is a protein devoid of its characteristic prosthetic group or metal. KEGG:C16240 chebi_ontology apoproteins CHEBI:13850 apoprotein apoproteins ChEBI apoproteins chebi Any main group molecular entity that is gaseous at standard temperature and pressure (STP; 0degreeC and 100 kPa). Any main group molecular entity that is gaseous at standard temperature and pressure (STP; 0°C and 100 kPa). Wikipedia:https://en.wikipedia.org/wiki/Gas chebi_ontology gas molecular entities gaseous molecular entities gaseous molecular entity CHEBI:138675 gas molecular entity gas molecular entities ChEBI gas molecular entities chebi gaseous molecular entities ChEBI gaseous molecular entities chebi gaseous molecular entity ChEBI gaseous molecular entity chebi chebi_ontology Carbamat Karbamat carbamate carbamate ion carbamic acid, ion(1-) CHEBI:13941 carbamate Carbamat ChEBI Carbamat chebi Karbamat ChEBI Karbamat chebi carbamate uniprot_ft carbamate ion ChemIDplus carbamate ion chemidplus carbamic acid, ion(1-) ChemIDplus carbamic acid, ion(1-) chemidplus A ketone containing a hydroxy group on the alpha-carbon relative to the C=O group. A ketone containing a hydroxy group on the α-carbon relative to the C=O group. chebi_ontology alpha-hydroxy ketones alpha-hydroxy-ketone alpha-hydroxy-ketones alpha-hydroxyketone alpha-hydroxyketones CHEBI:139588 alpha-hydroxy ketone alpha-hydroxy ketones ChEBI alpha-hydroxy ketones chebi alpha-hydroxy-ketone ChEBI alpha-hydroxy-ketone chebi alpha-hydroxy-ketones ChEBI alpha-hydroxy-ketones chebi alpha-hydroxyketone ChEBI alpha-hydroxyketone chebi alpha-hydroxyketones ChEBI alpha-hydroxyketones chebi A carboxylic acid anion obtained by deprotonation of any retinoid carboxy group. chebi_ontology retinoate retinoates retinoid anions retinoid carboxylate anion retinoid carboxylate anions retinoid carboxylic acid anion retinoid carboxylic acid anions CHEBI:139589 retinoid anion retinoate chebi retinoates chebi retinoid anions chebi retinoid carboxylate anion chebi retinoid carboxylate anions chebi retinoid carboxylic acid anion chebi retinoid carboxylic acid anions chebi An alpha-hydroxy ketone in which the carbonyl group and the hydroxy group are linked by a -CH2 (methylene) group. An α-hydroxy ketone in which the carbonyl group and the hydroxy group are linked by a -CH<small>₂</small> (methylene) group. chebi_ontology primary alpha-hydroxy ketones primary alpha-hydroxy-ketone primary alpha-hydroxy-ketones primary alpha-hydroxyketone primary alpha-hydroxyketones CHEBI:139590 primary alpha-hydroxy ketone primary alpha-hydroxy ketones ChEBI primary alpha-hydroxy ketones chebi primary alpha-hydroxy-ketone ChEBI primary alpha-hydroxy-ketone chebi primary alpha-hydroxy-ketones ChEBI primary alpha-hydroxy-ketones chebi primary alpha-hydroxyketone ChEBI primary alpha-hydroxyketone chebi primary alpha-hydroxyketones ChEBI primary alpha-hydroxyketones chebi A carboxamide resulting from the formal condensation of a carboxylic acid with a primary amine; formula RC(=O)NHR(1). A carboxamide resulting from the formal condensation of a carboxylic acid with a primary amine; formula RC(=O)NHR<small>^1</small>. chebi_ontology secondary carboxamides CHEBI:140325 secondary carboxamide secondary carboxamides ChEBI secondary carboxamides chebi Any saturated fatty acid containing 4 carbons. chebi_ontology CHEBI:140601 fatty acid 4:0 A primary ammonium ion resulting from the protonation of the amino group of L-tyrosinal. MetaCyc:CPD-21526 (2S)-1-(p-hydroxyphenyl)-3-oxopropan-2-aminium L-tyrosinal CHEBI:141668 L-tyrosinal(1+) (2S)-1-(p-hydroxyphenyl)-3-oxopropan-2-aminium ChEBI L-tyrosinal UniProt An antigenic epitope recognized by an anti-bilirubin monoclonal antibody designated 24G7. A substructure of bilirubin IXalpha, it is the region containing the oxo group at C-1, the methyl group at C-2, C-(4, 5, 6, 9), and N-21 and -22. An antigenic epitope recognized by an anti-bilirubin monoclonal antibody designated 24G7. A substructure of bilirubin IXα, it is the region containing the oxo group at C-1, the methyl group at C-2, C-(4, 5, 6, 9), and N-21 and -22. chebi_ontology CHEBI:142163 24G7 epitope A purine ribonucleoside that is a purine derivative attached to a beta-D-ribofuranosyl residue at position 9 via a glycosidic (N-glycosyl) linkage. A purine ribonucleoside that is a purine derivative attached to a β-<small>D</small>-ribofuranosyl residue at position 9 via a glycosidic (<em>N</em>-glycosyl) linkage. chebi_ontology a purine D-ribonucleoside CHEBI:142355 purines D-ribonucleoside a purine D-ribonucleoside UniProt a purine D-ribonucleoside uniprot_ft An alpha-amino-acid anion that is the conjugate base of glutamic acid, having anionic carboxy groups and a cationic amino group An α-amino-acid anion that is the conjugate base of glutamic acid, having anionic carboxy groups and a cationic amino group glutamate(1-) chebi_ontology 2-ammoniopentanedioate glutamate glutamate(1-) glutamic acid monoanion CHEBI:14321 glutamate(1-) glutamate(1-) JCBN 2-ammoniopentanedioate IUPAC 2-ammoniopentanedioate iupac glutamate UniProt glutamate uniprot_ft glutamate(1-) jcbn glutamic acid monoanion JCBN glutamic acid monoanion jcbn chebi_ontology 11-hydroperoxy-(5Z,8Z,12E,14Z)-eicosatetraenoate 11-hydroperoxy-(5Z,8Z,12E,14Z)-icosatetraenoate(1-) CHEBI:146291 11-HPETE(1-) 11-hydroperoxy-(5Z,8Z,12E,14Z)-eicosatetraenoate uniprot_ft 11-hydroperoxy-(5Z,8Z,12E,14Z)-icosatetraenoate(1-) submitter Any agent that induces nausea and vomiting. chebi_ontology emetics CHEBI:149552 emetic emetics chebi A divalent inorganic anion obtained by removal of both protons from hydrogen sulfide. chebi_ontology S(2-) Sulfide sulphide CHEBI:15138 sulfide(2-) S(2-) iupac Sulfide chemidplus sulphide chebi A molecular entity that can accept an electron, a pair of electrons, an atom or a group from another molecular entity. CHEBI:13699 CHEBI:2377 KEGG:C00028 KEGG:C16722 Acceptor chebi_ontology A Acceptor Akzeptor Hydrogen-acceptor Oxidized donor accepteur CHEBI:15339 acceptor Acceptor KEGG_COMPOUND A KEGG_COMPOUND A kegg.compound Acceptor kegg.compound Akzeptor ChEBI Akzeptor chebi Hydrogen-acceptor KEGG_COMPOUND Hydrogen-acceptor kegg.compound Oxidized donor KEGG_COMPOUND Oxidized donor kegg.compound accepteur ChEBI accepteur chebi A choline that is the parent compound of the cholines class, consisting of ethanolamine having three methyl substituents attached to the amino function. CHEBI:13985 CHEBI:23212 CHEBI:3665 CHEBI:41524 DrugBank:DB00122 ECMDB:ECMDB00097 HMDB:HMDB0000097 KEGG:C00114 KEGG:D07690 KNApSAcK:C00007298 MetaCyc:CHOLINE PDBeChem:CHT Wikipedia:Choline YMDB:YMDB00227 Choline choline chebi_ontology Bilineurine CHOLINE ION Choline N,N,N-trimethylethanol-ammonium N-trimethylethanolamine choline trimethylethanolamine CHEBI:15354 choline Choline KEGG_COMPOUND choline UniProt Bilineurine KEGG_COMPOUND Bilineurine kegg.compound CHOLINE ION PDBeChem CHOLINE ION pdb-ccd Choline kegg.compound N,N,N-trimethylethanol-ammonium ChEBI N,N,N-trimethylethanol-ammonium chebi N-trimethylethanolamine ChEBI N-trimethylethanolamine chebi choline uniprot_ft trimethylethanolamine ChEBI trimethylethanolamine chebi Actylcholine is an ester of acetic acid and choline, which acts as a neurotransmitter. CHEBI:12686 CHEBI:13715 CHEBI:22197 CHEBI:2416 CHEBI:40559 DrugBank:DB03128 KEGG:C01996 LINCS:LSM-5888 PDBeChem:ACH Wikipedia:Acetylcholine ACETYLCHOLINE Acetylcholine acetylcholine chebi_ontology ACETYLCHOLINE ACh Acetylcholine Azetylcholin O-Acetylcholine acetylcholine choline acetate CHEBI:15355 acetylcholine ACETYLCHOLINE PDBeChem Acetylcholine KEGG_COMPOUND acetylcholine UniProt ACETYLCHOLINE pdb-ccd ACh ChemIDplus ACh chemidplus Acetylcholine kegg.compound Azetylcholin ChEBI Azetylcholin chebi O-Acetylcholine KEGG_COMPOUND O-Acetylcholine kegg.compound acetylcholine uniprot_ft choline acetate ChemIDplus choline acetate chemidplus A sulfur-containing amino acid that is propanoic acid with an amino group at position 2 and a sulfanyl group at position 3. CHEBI:14061 CHEBI:23508 CHEBI:4050 Cysteine chebi_ontology 2-Amino-3-mercaptopropionic acid 2-amino-3-mercaptopropanoic acid 2-amino-3-sulfanylpropanoic acid C Cys Cystein Cysteine Hcys Zystein cisteina cysteine CHEBI:15356 cysteine Cysteine KEGG_COMPOUND 2-Amino-3-mercaptopropionic acid kegg.compound 2-amino-3-mercaptopropanoic acid jcbn 2-amino-3-sulfanylpropanoic acid iupac C chebi Cys chebi Cystein chebi Cysteine kegg.compound Hcys iupac Zystein chebi cisteina chebi cysteine chebi A simple monocarboxylic acid containing two carbons. CHEBI:22169 CHEBI:2387 CHEBI:40486 HMDB:HMDB0000042 KEGG:C00033 KEGG:D00010 KNApSAcK:C00001176 MetaCyc:ACET PDBeChem:ACT PDBeChem:ACY PPDB:1333 Wikipedia:Acetic_acid ACETIC ACID Acetic acid chebi_ontology ACETIC ACID AcOH Acetic acid CH3-COOH CH3CO2H E 260 E-260 E260 Essigsaeure Ethanoic acid Ethylic acid HOAc INS No. 260 MeCO2H MeCOOH Methanecarboxylic acid acide acetique ethoic acid CHEBI:15366 acetic acid ACETIC ACID PDBeChem Acetic acid KEGG_COMPOUND ACETIC ACID pdb-ccd AcOH ChEBI AcOH chebi Acetic acid kegg.compound CH3-COOH IUPAC CH3-COOH iupac CH3CO2H ChEBI CH3CO2H chebi E 260 ChEBI E 260 chebi E-260 ChEBI E-260 chebi E260 ChEBI E260 chebi Essigsaeure ChEBI Essigsaeure chebi Ethanoic acid KEGG_COMPOUND Ethanoic acid kegg.compound Ethylic acid ChemIDplus Ethylic acid chemidplus HOAc ChEBI HOAc chebi INS No. 260 ChEBI INS No. 260 chebi MeCO2H ChEBI MeCO2H chebi MeCOOH ChEBI MeCOOH chebi Methanecarboxylic acid ChemIDplus Methanecarboxylic acid chemidplus acide acetique ChemIDplus acide acetique chemidplus ethoic acid ChEBI ethoic acid chebi A pterin derivative that consists of pterin bearing amino, oxo and 1,2-dihydroxypropyl substituents at positions 2, 4 and 6 respectively. The parent of the class of biopterins; the <small>L</small>-<i>erythro</i> isomer occurs widely in nature. CHEBI:13904 CHEBI:22880 CHEBI:3107 chebi_ontology 2-Amino-6-(1,2-dihydroxypropyl)-4(1H)-pteridinone 2-amino-6-(1,2-dihydroxypropyl)-4(1H)-pteridinone Biopterin CHEBI:15373 biopterin 2-Amino-6-(1,2-dihydroxypropyl)-4(1H)-pteridinone kegg.compound 2-amino-6-(1,2-dihydroxypropyl)-4(1H)-pteridinone chebi Biopterin kegg.compound An oxygen hydride consisting of an oxygen atom that is covalently bonded to two hydrogen atoms CHEBI:10743 CHEBI:13352 CHEBI:27313 CHEBI:42043 CHEBI:42857 CHEBI:43228 CHEBI:44292 CHEBI:44701 CHEBI:44819 CHEBI:5585 HMDB:HMDB0002111 KEGG:C00001 KEGG:D00001 MetaCyc:WATER MolBase:1 PDBeChem:HOH Wikipedia:Water WATER Water chebi_ontology BOUND WATER H(2)O H2O HOH WATER Wasser Water [OH2] acqua agua aqua dihydridooxygen dihydrogen oxide eau hydrogen hydroxide CHEBI:15377 water WATER PDBeChem Water KEGG_COMPOUND BOUND WATER PDBeChem BOUND WATER pdb-ccd H(2)O uniprot_ft H2O KEGG_COMPOUND UniProt H2O kegg.compound HOH ChEBI HOH chebi WATER pdb-ccd Wasser ChEBI Wasser chebi Water kegg.compound [OH2] IUPAC [OH2] iupac acqua ChEBI acqua chebi agua ChEBI agua chebi aqua ChEBI aqua chebi dihydridooxygen IUPAC dihydridooxygen iupac dihydrogen oxide IUPAC dihydrogen oxide iupac eau ChEBI eau chebi hydrogen hydroxide ChEBI hydrogen hydroxide chebi The general name for the hydrogen nucleus, to be used without regard to the hydrogen nuclear mass (either for hydrogen in its natural abundance or where it is not desired to distinguish between the isotopes). CHEBI:10744 CHEBI:13357 CHEBI:5584 KEGG:C00080 Hydron H(+) H+ CHEBI:15378 hydron Hydron KEGG_COMPOUND H(+) UniProt H+ KEGG_COMPOUND CHEBI:10745 CHEBI:13416 CHEBI:23833 CHEBI:25366 CHEBI:30491 CHEBI:44742 CHEBI:7860 HMDB:HMDB0001377 KEGG:C00007 KEGG:D00003 MetaCyc:OXYGEN-MOLECULE MolBase:750 PDBeChem:OXY Wikipedia:Oxygen Disauerstoff E 948 E-948 E948 O2 OXYGEN MOLECULE Oxygen [OO] dioxygene molecular oxygen CHEBI:15379 dioxygen Disauerstoff ChEBI E 948 ChEBI E-948 ChEBI E948 ChEBI O2 IUPAC KEGG_COMPOUND UniProt OXYGEN MOLECULE PDBeChem Oxygen KEGG_COMPOUND [OO] MolBase dioxygene ChEBI molecular oxygen ChEBI An adenosine 5'-phosphate in which the 5'-phosphate is a triphosphate group. It is involved in the transportation of chemical energy during metabolic pathways. CHEBI:10789 CHEBI:10841 CHEBI:13236 CHEBI:22249 CHEBI:2359 CHEBI:40938 DrugBank:DB00171 HMDB:HMDB0000538 KEGG:C00002 KEGG:D08646 KNApSAcK:C00001491 PDBeChem:ATP Patent:US3079379 Wikipedia:Adenosine_triphosphate ATP chebi_ontology ADENOSINE-5'-TRIPHOSPHATE ATP Adenosine 5'-triphosphate Adenosine triphosphate H4atp CHEBI:15422 ATP ATP KEGG_COMPOUND ADENOSINE-5'-TRIPHOSPHATE PDBeChem ADENOSINE-5'-TRIPHOSPHATE pdb-ccd ATP kegg.compound Adenosine 5'-triphosphate KEGG_COMPOUND Adenosine 5'-triphosphate kegg.compound Adenosine triphosphate ChemIDplus Adenosine triphosphate chemidplus H4atp IUPAC H4atp iupac The simplest (and the only achiral) proteinogenic amino acid, with a hydrogen atom as its side chain. CHEBI:10792 CHEBI:14344 CHEBI:24368 CHEBI:42964 CHEBI:5460 Aminoacetic acid GLYCINE Glycine chebi_ontology Aminoacetic acid Aminoessigsaeure G GLYCINE Gly Glycin Glycine Glycocoll Glykokoll Glyzin H2N-CH2-COOH Hgly Leimzucker aminoethanoic acid CHEBI:15428 glycine Aminoacetic acid KEGG_COMPOUND GLYCINE PDBeChem Glycine KEGG_COMPOUND Aminoacetic acid kegg.compound Aminoessigsaeure chebi G chebi GLYCINE pdb-ccd Gly kegg.compound Glycin chemidplus Glycine kegg.compound Glycocoll chemidplus Glykokoll chebi Glyzin chebi H2N-CH2-COOH iupac Hgly iupac Leimzucker chemidplus aminoethanoic acid chebi jcbn A triterpene consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration. CHEBI:10795 CHEBI:10843 CHEBI:15104 CHEBI:26746 CHEBI:9245 HMDB:HMDB0000256 KEGG:C00751 KNApSAcK:C00003755 MetaCyc:SQUALENE PDBeChem:SQL Wikipedia:Squalene Squalene squalene (all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene Spinacene Supraene CHEBI:15440 squalene Squalene KEGG_COMPOUND squalene UniProt (all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene NIST_Chemistry_WebBook Spinacene KEGG_COMPOUND Supraene KEGG_COMPOUND A peptide zwitterion obtained from the tranfer of a proton from the carboxy group to the amino group of any tripeptide. It contains an equal number of positively-charged and negatively-charged functional groups. Major structure at pH 7.3. chebi_ontology L-amino acid tripeptide zwitterion L-amino acid tripeptide zwitterions amino acid tripeptide zwitterion amino acid tripeptide zwitterions an L-amino acid tripeptide CHEBI:155837 tripeptide zwitterion L-amino acid tripeptide zwitterion chebi L-amino acid tripeptide zwitterions chebi amino acid tripeptide zwitterion chebi amino acid tripeptide zwitterions chebi an L-amino acid tripeptide uniprot_ft Aldehydic parent sugars (polyhydroxy aldehydes H[CH(OH)]<small>_<em>n</em></small>C(=O)H, <em>n</em> ≥ 2) and their intramolecular hemiacetals. Aldehydic parent sugars (polyhydroxy aldehydes H[CH(OH)]nC(=O)H, n >= 2) and their intramolecular hemiacetals. CHEBI:13755 CHEBI:22305 CHEBI:2561 KEGG:C01370 Wikipedia:Aldose Aldose chebi_ontology Aldose aldoses an aldose CHEBI:15693 aldose Aldose KEGG_COMPOUND Aldose kegg.compound aldoses ChEBI aldoses chebi an aldose UniProt an aldose uniprot_ft Any alpha-amino acid having L-configuration at the alpha-carbon. Any α-amino acid having <small>L</small>-configuration at the α-carbon. CHEBI:13072 CHEBI:13243 CHEBI:13797 CHEBI:21224 CHEBI:6175 KEGG:C00151 L-alpha-amino acid chebi_ontology L-2-Amino acid L-Amino acid L-alpha-amino acid L-alpha-amino acids CHEBI:15705 L-alpha-amino acid L-alpha-amino acid IUPAC L-2-Amino acid KEGG_COMPOUND L-2-Amino acid kegg.compound L-Amino acid KEGG_COMPOUND L-Amino acid kegg.compound L-alpha-amino acid iupac L-alpha-amino acids ChEBI L-alpha-amino acids chebi A tertiary amine oxide resulting from the oxidation of the amino group of trimethylamine. CHEBI:15262 CHEBI:15263 CHEBI:27126 CHEBI:9733 chebi_ontology (CH3)3NO Me3N(+)O(-) Me3N(O) N(CH3)3O TMAO Trimethylamine N-oxide Trimethylaminoxid trimethylamine N-oxide trimethylamine oxide trimethyloxamine CHEBI:15724 trimethylamine N-oxide (CH3)3NO iupac Me3N(+)O(-) chebi Me3N(O) chebi N(CH3)3O chebi TMAO nist Trimethylamine N-oxide kegg.compound Trimethylaminoxid chebi trimethylamine N-oxide uniprot_ft trimethylamine oxide nist trimethyloxamine chemidplus A primary alcohol is a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it. A primary alcohol is a compound in which a hydroxy group, ‒OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it. CHEBI:13676 CHEBI:14887 CHEBI:26262 CHEBI:57489 CHEBI:8406 KEGG:C00226 Primary alcohol chebi_ontology 1-Alcohol Primary alcohol a primary alcohol primary alcohols CHEBI:15734 primary alcohol Primary alcohol KEGG_COMPOUND 1-Alcohol KEGG_COMPOUND 1-Alcohol kegg.compound Primary alcohol kegg.compound a primary alcohol UniProt a primary alcohol uniprot_ft primary alcohols ChEBI primary alcohols chebi A monocarboxylic acid anion that is the conjugate base of formic acid. Induces severe metabolic acidosis and ocular injury in human subjects. CHEBI:14276 CHEBI:24081 HMDB:HMDB0000142 KEGG:C00058 MetaCyc:FORMATE Wikipedia:Formate chebi_ontology HCO2 anion aminate formate formiate formic acid, ion(1-) formylate hydrogen carboxylate methanoate CHEBI:15740 formate HCO2 anion NIST_Chemistry_WebBook HCO2 anion nist aminate ChEBI aminate chebi formate uniprot_ft formiate ChEBI formiate chebi formic acid, ion(1-) ChemIDplus formic acid, ion(1-) chemidplus formylate ChEBI formylate chebi hydrogen carboxylate ChEBI hydrogen carboxylate chebi methanoate ChEBI methanoate chebi Any fatty acid anion containing a ring composed of carbon atoms. Major microspecies at pH 7.3 chebi_ontology CHEBI:157668 carbocyclic fatty acid anion Any <em>N</em>-acyl-amino acid in which the amino acid moiety has <small>D</small> configuration. CHEBI:12474 CHEBI:21631 CHEBI:7224 chebi_ontology CHEBI:15778 N-acyl-D-amino acid A dicarboxylic acid dianion obtained by the deprotonation of the carboxy groups of malonic acid. CHEBI:14563 CHEBI:25130 CHEBI:44151 chebi_ontology (-)OOC-CH2-COO(-) MALONATE ION malo malonate malonic acid, ion(2-) propanedioic acid, ion(2-) CHEBI:15792 malonate(2-) (-)OOC-CH2-COO(-) chebi MALONATE ION pdb-ccd malo iupac malonate uniprot_ft malonic acid, ion(2-) chemidplus propanedioic acid, ion(2-) chemidplus A peptide containing ten or more amino acid residues. CHEBI:14860 CHEBI:8314 KEGG:C00403 Polypeptide chebi_ontology Polypeptid Polypeptide polipeptido CHEBI:15841 polypeptide Polypeptide KEGG_COMPOUND Polypeptid ChEBI Polypeptid chebi Polypeptide kegg.compound polipeptido ChEBI polipeptido chebi A long-chain fatty acid that is a C<small>₂₀</small>, polyunsaturated fatty acid having four (<i>Z</i>)-double bonds at positions 5, 8, 11 and 14. CHEBI:22608 CHEBI:2799 CHEBI:40501 chebi_ontology (5Z,8Z,11Z,14Z)-5,8,11,14-icosatetraenoic acid (5Z,8Z,11Z,14Z)-Icosatetraenoic acid AA ARA ARACHIDONIC ACID Arachidonate Arachidonic acid Arachidonsaeure all-cis-5,8,11,14-eicosatetraenoic acid cis-5,8,11,14-Eicosatetraenoic acid cis-Delta(5,8,11,14)-eicosatetraenoic acid CHEBI:15843 arachidonic acid (5Z,8Z,11Z,14Z)-5,8,11,14-icosatetraenoic acid nist (5Z,8Z,11Z,14Z)-Icosatetraenoic acid kegg.compound AA chebi ARA chebi ARACHIDONIC ACID pdb-ccd Arachidonate kegg.compound Arachidonic acid kegg.compound Arachidonsaeure chebi all-cis-5,8,11,14-eicosatetraenoic acid chebi cis-5,8,11,14-Eicosatetraenoic acid kegg.compound cis-Delta(5,8,11,14)-eicosatetraenoic acid chebi Any 3-hydroxy steroid whose skeleton is closely related to cholestan-3-ol (additional carbon atoms may be present in the side chain). CHEBI:13688 CHEBI:15114 CHEBI:26771 CHEBI:9266 chebi_ontology 3-hydroxysteroids Sterol a sterol CHEBI:15889 sterol 3-hydroxysteroids chebi Sterol kegg.compound a sterol uniprot_ft An amino sulfonic acid that is the 2-amino derivative of ethanesulfonic acid. It is a naturally occurring amino acid derived from methionine and cysteine metabolism. An abundant component of fish- and meat-based foods, it has been used as an oral supplement in the treatment of disorders such as cystic fibrosis and hypertension. CHEBI:15195 CHEBI:26852 CHEBI:45877 CHEBI:9406 2-Aminoethanesulfonic acid chebi_ontology 2-Aminoethanesulfonic acid 2-aminoethyl sulfonate Aminoethylsulfonic acid Taurine beta-aminoethylsulfonic acid CHEBI:15891 taurine 2-Aminoethanesulfonic acid KEGG_COMPOUND 2-Aminoethanesulfonic acid kegg.compound 2-aminoethyl sulfonate iubmb Aminoethylsulfonic acid kegg.compound Taurine kegg.compound beta-aminoethylsulfonic acid nist Any <em>N</em>-acylethanolamine in which the acyl group has a chain length of C<small>₁₂</small> or greater. CHEBI:12537 CHEBI:21485 CHEBI:7099 chebi_ontology an N-(long-chain fatty acyl)ethanolamine CHEBI:15897 N-(long-chain-acyl)ethanolamine an N-(long-chain fatty acyl)ethanolamine uniprot_ft A fatty acid with a chain length ranging from C<small>₁₃</small> to C<small>₂₂</small>. CHEBI:13655 CHEBI:14529 CHEBI:25075 CHEBI:6528 chebi_ontology Higher fatty acid LCFA LCFAs Long-chain fatty acid long-chain fatty acids CHEBI:15904 long-chain fatty acid Higher fatty acid kegg.compound LCFA chebi LCFAs chebi Long-chain fatty acid kegg.compound long-chain fatty acids chebi An optically active form of glutamic acid having <small>D</small>-configuration. An optically active form of glutamic acid having D-configuration. CHEBI:21023 CHEBI:4183 DrugBank:DB02517 HMDB:HMDB0003339 KEGG:C00217 KNApSAcK:C00019577 MetaCyc:D-GLT PDBeChem:DGL D-Glutamic acid chebi_ontology (R)-2-aminopentanedioic acid D-2-Aminoglutaric acid D-Glutamic acid D-Glutaminic acid D-Glutaminsaeure DGL glutamic acid D-form CHEBI:15966 D-glutamic acid D-Glutamic acid KEGG_COMPOUND (R)-2-aminopentanedioic acid ChEBI (R)-2-aminopentanedioic acid chebi D-2-Aminoglutaric acid KEGG_COMPOUND D-2-Aminoglutaric acid kegg.compound D-Glutamic acid kegg.compound D-Glutaminic acid KEGG_COMPOUND D-Glutaminic acid kegg.compound D-Glutaminsaeure ChEBI D-Glutaminsaeure chebi DGL PDBeChem DGL pdb-ccd glutamic acid D-form ChemIDplus glutamic acid D-form chemidplus A nucleobase-containing molecular entity with a polymeric structure comprised of a linear sequence of 13 or more nucleotide residues. CHEBI:13672 CHEBI:14859 CHEBI:8312 KEGG:C00419 Polynucleotide polynucleotides CHEBI:15986 polynucleotide Polynucleotide KEGG_COMPOUND polynucleotides ChEBI A member of the class of ethanolamines that is ethane with an amino substituent at C-1 and a hydroxy substituent at C-2, making it both a primary amine and a primary alcohol. CHEBI:14223 CHEBI:23979 CHEBI:272066 CHEBI:42323 CHEBI:4880 chebi_ontology 1-amino-2-hydroxyethane 2-Amino-ethanol 2-Hydroxyethylamine 2-amino-1-ethanol 2-aminoethan-1-ol 2-aminoethyl alcohol Aethanolamin Aminoethanol ETA Ethanolamine Hea MEA MONOETHANOLAMINE beta-aminoethanol beta-aminoethyl alcohol beta-ethanolamine beta-hydroxyethylamine colamine glycinol monoethanolamine CHEBI:16000 ethanolamine 1-amino-2-hydroxyethane chemidplus 2-Amino-ethanol chembl 2-Hydroxyethylamine kegg.compound 2-amino-1-ethanol nist 2-aminoethan-1-ol nist 2-aminoethyl alcohol nist Aethanolamin chemidplus Aminoethanol kegg.compound ETA chebi Ethanolamine kegg.compound Hea iupac MEA chemidplus MONOETHANOLAMINE chembl beta-aminoethanol nist beta-aminoethyl alcohol nist beta-ethanolamine nist beta-hydroxyethylamine nist colamine chemidplus glycinol chemidplus monoethanolamine chemidplus An optically active form of lactate having (<i>R</i>)-configuration. CHEBI:11001 CHEBI:18684 chebi_ontology (R)-lactate D-2-hydroxypropanoate D-2-hydroxypropionate D-lactate CHEBI:16004 (R)-lactate (R)-lactate uniprot_ft D-2-hydroxypropanoate chebi D-2-hydroxypropionate chebi D-lactate chebi An optically active form of glutamic acid having <small>L</small>-configuration. An optically active form of glutamic acid having L-configuration. CHEBI:21304 CHEBI:42825 CHEBI:6224 BPDB:2297 DrugBank:DB00142 HMDB:HMDB0000148 KEGG:C00025 KEGG:D00007 KNApSAcK:C00001358 LINCS:LSM-36375 MetaCyc:GLT PDBeChem:GLU_LFOH Wikipedia:L-Glutamic_Acid GLUTAMIC ACID L-Glutamic acid chebi_ontology (S)-2-aminopentanedioic acid (S)-glutamic acid E GLUTAMIC ACID Glu Glutamate L-Glu L-Glutamic acid L-Glutaminic acid L-Glutaminsaeure CHEBI:16015 L-glutamic acid GLUTAMIC ACID PDBeChem L-Glutamic acid KEGG_COMPOUND (S)-2-aminopentanedioic acid ChEBI (S)-2-aminopentanedioic acid chebi (S)-glutamic acid NIST_Chemistry_WebBook (S)-glutamic acid nist E ChEBI E chebi GLUTAMIC ACID PDBeChem GLUTAMIC ACID pdb-ccd Glu ChEBI Glu chebi Glutamate KEGG_COMPOUND Glutamate kegg.compound L-Glu ChEBI L-Glu chebi L-Glutamic acid kegg.compound L-Glutaminic acid KEGG_COMPOUND L-Glutaminic acid kegg.compound L-Glutaminsaeure ChEBI L-Glutaminsaeure chebi A monoatomic monoanion resulting from the addition of an electron to any halogen atom. CHEBI:14384 CHEBI:5605 chebi_ontology HX Halide a halide anion halide anions halide(1-) halides halogen anion CHEBI:16042 halide anion HX kegg.compound Halide kegg.compound a halide anion uniprot_ft halide anions chebi halide(1-) chebi halides chebi halogen anion chebi A γ-amino acid comprising 4-aminobutyric acid having a 2-hydroxy substituent. CHEBI:1780 CHEBI:20311 4-Amino-3-hydroxybutanoic acid chebi_ontology 3-hydroxy-GABA 4-Amino-3-hydroxybutanoic acid 4-amino-3-hydroxybutyric acid GABOB gamma-Amino-beta-hydroxybutyric acid CHEBI:16080 gamma-amino-beta-hydroxybutyric acid 4-Amino-3-hydroxybutanoic acid KEGG_COMPOUND 3-hydroxy-GABA chemidplus 4-Amino-3-hydroxybutanoic acid kegg.compound 4-amino-3-hydroxybutyric acid chemidplus GABOB kegg.compound gamma-Amino-beta-hydroxybutyric acid kegg.compound A cholestanoid consisting of cholestane having a double bond at the 5,6-position as well as a 3β-hydroxy group. CHEBI:13982 CHEBI:23204 CHEBI:3659 CHEBI:41564 Cholest-5-en-3beta-ol chebi_ontology (3beta,14beta,17alpha)-cholest-5-en-3-ol CHOLESTEROL Cholest-5-en-3beta-ol Cholesterin Cholesterol cholesterol CHEBI:16113 cholesterol Cholest-5-en-3beta-ol KEGG_COMPOUND (3beta,14beta,17alpha)-cholest-5-en-3-ol iupac CHOLESTEROL pdb-ccd Cholest-5-en-3beta-ol kegg.compound Cholesterin nist Cholesterol kegg.compound cholesterol uniprot_ft An azane that consists of a single nitrogen atom covelently bonded to three hydrogen atoms. CHEBI:13405 CHEBI:13406 CHEBI:13407 CHEBI:13771 CHEBI:22533 CHEBI:44269 CHEBI:44284 CHEBI:44404 CHEBI:7434 HMDB:HMDB0000051 KEGG:C00014 KEGG:D02916 KNApSAcK:C00007267 MetaCyc:AMMONIA MolBase:930 PDBeChem:NH3 Wikipedia:Ammonia AMMONIA Ammonia chebi_ontology AMMONIA Ammonia Ammoniak NH3 R-717 [NH3] ammoniac amoniaco spirit of hartshorn CHEBI:16134 ammonia AMMONIA PDBeChem Ammonia KEGG_COMPOUND AMMONIA pdb-ccd Ammonia kegg.compound Ammoniak ChemIDplus Ammoniak chemidplus NH3 IUPAC KEGG_COMPOUND NH3 iupac kegg.compound R-717 ChEBI R-717 chebi [NH3] MolBase [NH3] molbase ammoniac ChEBI ammoniac chebi amoniaco ChEBI amoniaco chebi spirit of hartshorn ChemIDplus spirit of hartshorn chemidplus A sulfur hydride consisting of a single sulfur atom bonded to two hydrogen atoms. A highly poisonous, flammable gas with a characteristic odour of rotten eggs, it is often produced by bacterial decomposition of organic matter in the absence of oxygen. CHEBI:13356 CHEBI:14414 CHEBI:24639 CHEBI:43058 CHEBI:45489 CHEBI:5787 Hydrogen sulfide chebi_ontology H2S HYDROSULFURIC ACID Hydrogen sulfide Hydrogen-sulfide Schwefelwasserstoff Sulfide [SH2] acide sulfhydrique dihydrogen monosulfide dihydrogen sulfide hydrogen monosulfide hydrogen sulphide hydrogene sulfure sulfure d'hydrogene CHEBI:16136 hydrogen sulfide Hydrogen sulfide KEGG_COMPOUND H2S iupac kegg.compound HYDROSULFURIC ACID pdb-ccd Hydrogen sulfide kegg.compound Hydrogen-sulfide kegg.compound Schwefelwasserstoff chemidplus Sulfide kegg.compound [SH2] molbase acide sulfhydrique chemidplus dihydrogen monosulfide nist dihydrogen sulfide nist hydrogen monosulfide nist hydrogen sulphide chemidplus hydrogene sulfure chemidplus sulfure d'hydrogene chebi A mucopolysaccharide composed of repeating beta-D-glucopyranuronosyl-(1->3)-beta-D-N-acetylgalactosaminyl units. CHEBI:13989 CHEBI:13992 CHEBI:23221 CHEBI:3673 KEGG:C00401 KEGG:G11334 Chondroitin Chondroitin-D-glucuronate CHEBI:16137 chondroitin D-glucuronate Chondroitin KEGG_COMPOUND Chondroitin-D-glucuronate KEGG_COMPOUND A one-carbon compound in which the carbon is attached by single bonds to four hydrogen atoms. It is a colourless, odourless, non-toxic but flammable gas (b.p. −161°C). CHEBI:14585 CHEBI:25220 CHEBI:6811 Methane chebi_ontology CH4 Methan Methane marsh gas metano methane methyl hydride CHEBI:16183 methane Methane KEGG_COMPOUND CH4 iupac Methan chebi Methane kegg.compound marsh gas nist metano chebi methane chebi uniprot_ft methyl hydride chemidplus A sulfur oxoanion obtained by deprotonation of both OH groups of sulfuric acid. CHEBI:15135 CHEBI:45687 CHEBI:9335 HMDB:HMDB0001448 KEGG:C00059 KEGG:D05963 MetaCyc:SULFATE PDBeChem:SO4 Wikipedia:Sulfate Sulfate chebi_ontology SO4(2-) SULFATE ION Sulfate Sulfate anion(2-) Sulfate dianion Sulfate(2-) Sulfuric acid ion(2-) [SO4](2-) sulfate sulphate sulphate ion CHEBI:16189 sulfate Sulfate KEGG_COMPOUND SO4(2-) IUPAC SO4(2-) iupac SULFATE ION PDBeChem SULFATE ION pdb-ccd Sulfate kegg.compound Sulfate anion(2-) HMDB Sulfate anion(2-) hmdb Sulfate dianion HMDB Sulfate dianion hmdb Sulfate(2-) HMDB Sulfate(2-) hmdb Sulfuric acid ion(2-) HMDB Sulfuric acid ion(2-) hmdb [SO4](2-) IUPAC [SO4](2-) iupac sulfate uniprot_ft sulphate ChEBI sulphate chebi sulphate ion ChEBI sulphate ion chebi A carbonyl group with two C-bound amine groups. The commercially available fertilizer has an analysis of 46-0-0 (N-P2O5-K2O). CHEBI:15292 CHEBI:27218 CHEBI:46379 CHEBI:9888 UREA Urea chebi_ontology 1728 Carbamide E927b H2NC(O)NH2 Harnstoff Karbamid UREA Urea carbonyldiamide ur urea uree CHEBI:16199 urea UREA PDBeChem Urea KEGG_COMPOUND 1728 ppdb Carbamide kegg.compound E927b chebi H2NC(O)NH2 chebi Harnstoff nist Karbamid chebi UREA pdb-ccd Urea kegg.compound carbonyldiamide nist ur iupac urea uniprot_ft uree chebi CHEBI:13365 CHEBI:13419 CHEBI:44641 CHEBI:5594 KEGG:C01328 PDBeChem:OH chebi_ontology HO- HYDROXIDE ION Hydroxide ion OH(-) OH- CHEBI:16234 hydroxide HO- KEGG_COMPOUND HO- kegg.compound HYDROXIDE ION PDBeChem HYDROXIDE ION pdb-ccd Hydroxide ion KEGG_COMPOUND Hydroxide ion kegg.compound OH(-) IUPAC OH(-) iupac OH- KEGG_COMPOUND OH- kegg.compound An inorganic peroxide consisting of two hydroxy groups joined by a covalent oxygen-oxygen single bond. CHEBI:13354 CHEBI:13355 CHEBI:24637 CHEBI:44812 CHEBI:5586 HYDROGEN PEROXIDE Hydrogen peroxide chebi_ontology H(2)O(2) H2O2 HOOH HYDROGEN PEROXIDE Hydrogen peroxide Oxydol [OH(OH)] dihydrogen dioxide perhydrol CHEBI:16240 hydrogen peroxide HYDROGEN PEROXIDE PDBeChem Hydrogen peroxide KEGG_COMPOUND H(2)O(2) uniprot_ft H2O2 kegg.compound HOOH iupac HYDROGEN PEROXIDE pdb-ccd Hydrogen peroxide kegg.compound Oxydol kegg.compound [OH(OH)] molbase dihydrogen dioxide iupac perhydrol metacyc.compound A lipid containing phosphoric acid as a mono- or di-ester. The term encompasses phosphatidic acids and phosphoglycerides. CHEBI:14816 CHEBI:26063 CHEBI:8150 KEGG:C00865 Phospholipid chebi_ontology Phospholipid a phospholipid derivative phospholipids CHEBI:16247 phospholipid Phospholipid KEGG_COMPOUND Phospholipid kegg.compound a phospholipid derivative UniProt a phospholipid derivative uniprot_ft phospholipids ChEBI phospholipids chebi The nitrogen oxoanion formed by loss of a proton from nitrous acid. CHEBI:14658 CHEBI:44396 CHEBI:7585 Nitrite chebi_ontology NITRITE ION NO2 NO2(-) Nitrit Nitrite [NO2](-) nitrite nitrite anion nitrite(1-) nitrous acid, ion(1-) CHEBI:16301 nitrite Nitrite KEGG_COMPOUND NITRITE ION pdb-ccd NO2 chebi NO2(-) iupac Nitrit chebi Nitrite kegg.compound [NO2](-) iupac nitrite uniprot_ft nitrite anion chemidplus nitrite(1-) chemidplus nitrous acid, ion(1-) chemidplus A 17β-hydroxy steroid that is testosterone in which the 4,5 double bond has been reduced to a single bond with α-configuration at position 5. CHEBI:11341 CHEBI:11342 CHEBI:19175 CHEBI:41876 CHEBI:793 17beta-Hydroxy-5alpha-androstan-3-one 17beta-hydroxy-5alpha-androstan-3-one chebi_ontology 17-beta-hydroxy-5-alpha-androstan-3-one 17beta-Hydroxy-5alpha-androstan-3-one 17beta-Hydroxyandrostan-3-one 17beta-hydroxy-5alpha-androstan-3-one 17beta-hydroxyandrostan-3-one 4,5alpha-dihydrotestosterone 5alpha-DHT 5alpha-Dihydrotestosterone 5alpha-dihydrotestosterone Androstanolone DHT DIHYDROTESTOSTERONE Dihydrotestosteron Stanolone dihydrotestosterone CHEBI:16330 17beta-hydroxy-5alpha-androstan-3-one 17beta-Hydroxy-5alpha-androstan-3-one KEGG_COMPOUND 17beta-hydroxy-5alpha-androstan-3-one ChEBI 17-beta-hydroxy-5-alpha-androstan-3-one uniprot_ft 17beta-Hydroxy-5alpha-androstan-3-one kegg.compound 17beta-Hydroxyandrostan-3-one kegg.compound 17beta-hydroxy-5alpha-androstan-3-one chebi 17beta-hydroxyandrostan-3-one chebi 4,5alpha-dihydrotestosterone chebi 5alpha-DHT chebi 5alpha-Dihydrotestosterone kegg.compound 5alpha-dihydrotestosterone chebi Androstanolone kegg.compound DHT pdb-ccd DIHYDROTESTOSTERONE pdb-ccd Dihydrotestosteron chebi Stanolone nist dihydrotestosterone chebi A ribonucleoside composed of a molecule of adenine attached to a ribofuranose moiety via a beta-N(9)-glycosidic bond. A ribonucleoside composed of a molecule of adenine attached to a ribofuranose moiety via a β‒N<small>^9</small>-glycosidic bond. CHEBI:13734 CHEBI:22237 CHEBI:2472 CHEBI:40558 CHEBI:40825 CHEBI:40906 CHEBI:40911 DrugBank:DB00640 ECMDB:ECMDB00050 HMDB:HMDB0000050 KEGG:C00212 KEGG:D00045 KNApSAcK:C00007444 LINCS:LSM-28568 MetaCyc:ADENOSINE PDBeChem:ADN PDBeChem:ArF00 PDBeChem:ArS00 Wikipedia:Adenosine YMDB:YMDB00058 ADENOSINE Adenosine chebi_ontology (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol 6-Amino-9-beta-D-ribofuranosyl-9H-purine 9-beta-D-Ribofuranosidoadenine 9-beta-D-Ribofuranosyl-9H-purin-6-amine 9-beta-D-ribofuranosyl-9H-purin-6-amine 9-beta-D-ribofuranosyladenine ADENOSINE Ade-Rib Adenosin Adenosine Ado adenine riboside adenosine beta-D-adenosine CHEBI:16335 adenosine ADENOSINE PDBeChem Adenosine KEGG_COMPOUND (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol DrugBank (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol drugbank 6-Amino-9-beta-D-ribofuranosyl-9H-purine ChemIDplus 6-Amino-9-beta-D-ribofuranosyl-9H-purine chemidplus 9-beta-D-Ribofuranosidoadenine ChemIDplus 9-beta-D-Ribofuranosidoadenine chemidplus 9-beta-D-Ribofuranosyl-9H-purin-6-amine ChemIDplus 9-beta-D-Ribofuranosyl-9H-purin-6-amine chemidplus 9-beta-D-ribofuranosyl-9H-purin-6-amine ChEBI 9-beta-D-ribofuranosyl-9H-purin-6-amine chebi 9-beta-D-ribofuranosyladenine HMDB 9-beta-D-ribofuranosyladenine hmdb ADENOSINE pdb-ccd Ade-Rib CBN Ade-Rib iubmb Adenosin ChEBI Adenosin chebi Adenosine kegg.compound Ado CBN Ado iubmb adenine riboside HMDB adenine riboside hmdb adenosine uniprot_ft beta-D-adenosine ChemIDplus beta-D-adenosine chemidplus A mucopolysaccharide composed of <em>N</em>-acetylglucosamine and glucuronic acid subunits. It is found in the connective tissues of vertebrates. A principal constituent of the extracellular matrix (ECM), it mediates the growth and metastasis of tumour cells. A mucopolysaccharide composed of N-acetylglucosamine and glucuronic acid subunits. It is found in the connective tissues of vertebrates. A principal constituent of the extracellular matrix (ECM), it mediates the growth and metastasis of tumour cells. CHEBI:14412 CHEBI:24622 CHEBI:24623 CHEBI:30942 CHEBI:5772 HMDB:HMDB0010366 KEGG:C00518 KEGG:D08043 KEGG:G10505 Wikipedia:Hyaluronan Hyaluronic acid chebi_ontology Hyaluronic acid Hyaluronsaeure [beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n [beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n acide hyaluronique acido hialuronico hyaluronan CHEBI:16336 hyaluronic acid Hyaluronic acid KEGG_COMPOUND Hyaluronic acid kegg.compound Hyaluronsaeure ChEBI Hyaluronsaeure chebi [beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n ChEBI [beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n chebi [beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n KEGG_COMPOUND [beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n kegg.compound acide hyaluronique ChEBI acide hyaluronique chebi acido hialuronico ChEBI acido hialuronico chebi hyaluronan ChEBI hyaluronan chebi An optically active form of cysteine having <small>D</small>-configuration. CHEBI:12919 CHEBI:20921 CHEBI:4111 CHEBI:41887 D-CYSTEINE D-Cysteine chebi_ontology (2S)-2-amino-3-mercaptopropanoic acid (2S)-2-amino-3-sulfanylpropanoic acid (S)-2-amino-3-mercaptopropanoic acid D-Amino-3-mercaptopropionic acid D-CYSTEINE D-Cystein D-Cysteine D-Zystein DCY CHEBI:16375 D-cysteine D-CYSTEINE PDBeChem D-Cysteine KEGG_COMPOUND (2S)-2-amino-3-mercaptopropanoic acid jcbn (2S)-2-amino-3-sulfanylpropanoic acid iupac (S)-2-amino-3-mercaptopropanoic acid chebi D-Amino-3-mercaptopropionic acid kegg.compound D-CYSTEINE pdb-ccd D-Cystein chebi D-Cysteine kegg.compound D-Zystein chebi DCY pdb-ccd Compounds having the structure RSR (R ≠ H). Such compounds were once called thioethers. CHEBI:13694 CHEBI:26960 CHEBI:9340 chebi_ontology RSR Sulfide Thioether organic sulfides thioethers CHEBI:16385 organic sulfide RSR iupac Sulfide kegg.compound Thioether kegg.compound organic sulfides chebi thioethers iupac A sphing-4-enine in which the double bond is <i>trans</i>. CHEBI:15102 CHEBI:207585 CHEBI:26741 CHEBI:9224 chebi_ontology (2S,3R)-(E)-2-amino-1,3-dihydroxy-4-octadecene (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-ene-1-ol (2S,3R,4E)-2-amino-4-octadecene-1,3-diol (2S,3R,E)-2-aminooctadec-4-ene-1,3-diol (4E)-sphing-4-enine (4E)-sphingenine (E)-2-amino-4-octadecan-1,3-diol (E)-D-erythro-4-octadecene-1,3-diol 2-amino-4-octadecene-1,3-diol C18 sphingosine D-(+)-erythro-1,3-dihydroxy-2-amino-4-trans-octadecene D-erythro-sphingosine Sph Sphing-4-enine Sphingenine Sphingoid Sphingosine Sphingosine d18:1 sphingosin trans-4-sphingenine trans-D-erythro-2-amino-4-octadecene-1,3-diol CHEBI:16393 sphingosine (2S,3R)-(E)-2-amino-1,3-dihydroxy-4-octadecene chebi (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-ene-1-ol chebi (2S,3R,4E)-2-amino-4-octadecene-1,3-diol iubmb (2S,3R,E)-2-aminooctadec-4-ene-1,3-diol chembl (4E)-sphing-4-enine iupac (4E)-sphingenine iubmb (E)-2-amino-4-octadecan-1,3-diol chemidplus (E)-D-erythro-4-octadecene-1,3-diol chebi 2-amino-4-octadecene-1,3-diol chebi C18 sphingosine chebi D-(+)-erythro-1,3-dihydroxy-2-amino-4-trans-octadecene chebi D-erythro-sphingosine chebi Sph iubmb Sphing-4-enine kegg.compound Sphingenine kegg.compound Sphingoid kegg.compound Sphingosine kegg.compound Sphingosine d18:1 chebi sphingosin chebi trans-4-sphingenine iubmb trans-D-erythro-2-amino-4-octadecene-1,3-diol chebi An α-amino acid that consists of propionic acid bearing an amino substituent at position 2. CHEBI:13748 CHEBI:22277 CHEBI:2539 2-Aminopropanoic acid Alanine chebi_ontology 2-Aminopropanoic acid 2-Aminopropionic acid A ALA Alanin Alanine alanina CHEBI:16449 alanine 2-Aminopropanoic acid KEGG_COMPOUND Alanine KEGG_COMPOUND 2-Aminopropanoic acid kegg.compound 2-Aminopropionic acid kegg.compound A chebi ALA chebi Alanin chebi Alanine kegg.compound alanina chebi A one-carbon compound with formula CO2 in which the carbon is attached to each oxygen atom by a double bond. A colourless, odourless gas under normal conditions, it is produced during respiration by all animals, fungi and microorganisms that depend directly or indirectly on living or decaying plants for food. A one-carbon compound with formula CO<small>₂</small> in which the carbon is attached to each oxygen atom by a double bond. A colourless, odourless gas under normal conditions, it is produced during respiration by all animals, fungi and microorganisms that depend directly or indirectly on living or decaying plants for food. CHEBI:13282 CHEBI:13283 CHEBI:13284 CHEBI:13285 CHEBI:23011 CHEBI:3283 CHEBI:48829 HMDB:HMDB0001967 KEGG:C00011 KEGG:D00004 MetaCyc:CARBON-DIOXIDE MolBase:752 PDBeChem:CO2 PPDB:119 Wikipedia:Carbon_dioxide CARBON DIOXIDE Carbon dioxide chebi_ontology CARBON DIOXIDE CO(2) CO2 Carbon dioxide E 290 E-290 E290 R-744 [CO2] carbonic anhydride CHEBI:16526 carbon dioxide CARBON DIOXIDE PDBeChem Carbon dioxide KEGG_COMPOUND CARBON DIOXIDE pdb-ccd CO(2) uniprot_ft CO2 KEGG_COMPOUND UniProt CO2 kegg.compound Carbon dioxide kegg.compound E 290 ChEBI E 290 chebi E-290 ChEBI E-290 chebi E290 ChEBI E290 chebi R-744 ChEBI R-744 chebi [CO2] MolBase [CO2] molbase carbonic anhydride UM-BBD carbonic anhydride umbbd.compound A naturally occurring polypeptide synthesized at the ribosome. CHEBI:8526 KEGG:C00017 chebi_ontology Protein a protein polypeptide chain protein polypeptide chains CHEBI:16541 protein polypeptide chain Protein KEGG_COMPOUND Protein kegg.compound a protein UniProt a protein uniprot_ft polypeptide chain ChEBI polypeptide chain chebi protein polypeptide chains ChEBI protein polypeptide chains chebi Any member of the class of organooxygen compounds that is a polyhydroxy-aldehyde or -ketone or a lactol resulting from their intramolecular condensation (monosaccharides); substances derived from these by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom; and polymeric products arising by intermolecular acetal formation between two or more such molecules (disaccharides, polysaccharides and oligosaccharides). Carbohydrates contain only carbon, hydrogen and oxygen atoms; prior to any oxidation or reduction, most have the empirical formula C<small>_<em>m</em></small>(H<small>₂</small>O)<small>_<em>n</em></small>. Compounds obtained from carbohydrates by substitution, etc., are known as carbohydrate derivatives and may contain other elements. Cyclitols are generally not regarded as carbohydrates. Any member of the class of organooxygen compounds that is a polyhydroxy-aldehyde or -ketone or a lactol resulting from their intramolecular condensation (monosaccharides); substances derived from these by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom; and polymeric products arising by intermolecular acetal formation between two or more such molecules (disaccharides, polysaccharides and oligosaccharides). Carbohydrates contain only carbon, hydrogen and oxygen atoms; prior to any oxidation or reduction, most have the empirical formula Cm(H2O)n. Compounds obtained from carbohydrates by substitution, etc., are known as carbohydrate derivatives and may contain other elements. Cyclitols are generally not regarded as carbohydrates. CHEBI:15131 CHEBI:23008 CHEBI:9318 Wikipedia:Carbohydrate chebi_ontology Kohlenhydrat Kohlenhydrate a carbohydrate carbohidrato carbohidratos glucide glucides glucido glucidos hydrates de carbone saccharide saccharides saccharidum CHEBI:16646 carbohydrate Kohlenhydrat ChEBI Kohlenhydrat chebi Kohlenhydrate ChEBI Kohlenhydrate chebi a carbohydrate UniProt a carbohydrate uniprot_ft carbohidrato IUPAC carbohidrato iupac carbohidratos IUPAC carbohidratos iupac glucide ChEBI glucide chebi glucides ChEBI glucides chebi glucido ChEBI glucido chebi glucidos ChEBI glucidos chebi hydrates de carbone ChEBI hydrates de carbone chebi saccharide IUPAC saccharide iupac saccharides IUPAC saccharides iupac saccharidum ChEBI saccharidum chebi An optically active form of lactate having (<i>S</i>)-configuration. CHEBI:11065 CHEBI:12411 CHEBI:18783 chebi_ontology (+)-lactate (S)-lactate L(+)-lactate L-(+)-lactate L-lactate CHEBI:16651 (S)-lactate (+)-lactate chebi (S)-lactate uniprot_ft L(+)-lactate chebi L-(+)-lactate chebi L-lactate umbbd.compound An oxo dicarboxylic acid that consists of 4-hydroxycyclohexa-2,5-diene-1-carboxylic acid substituted by a 2-carboxy-2-oxoethyl group at position 1. CHEBI:26257 CHEBI:45028 CHEBI:8399 DrugBank:DB08427 HMDB:HMDB0012283 KNApSAcK:C00019632 PDBeChem:PRE Wikipedia:Prephenic_acid PREPHENIC ACID Prephenic acid 1-Carboxy-4-hydroxy-2,5-cyclohexadiene-1-pyruvic acid 1-carboxy-4-hydroxy-alpha-oxo-2,5-cyclohexadiene-1-propanoic acid CHEBI:16666 prephenic acid PREPHENIC ACID PDBeChem Prephenic acid KEGG_COMPOUND 1-Carboxy-4-hydroxy-2,5-cyclohexadiene-1-pyruvic acid ChemIDplus 1-carboxy-4-hydroxy-alpha-oxo-2,5-cyclohexadiene-1-propanoic acid ChemIDplus Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from alpha-amino acids, but it includes those derived from any amino carboxylic acid. X = OH, OR, NH2, NHR, etc. Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from α-amino acids, but it includes those derived from any amino carboxylic acid. X = OH, OR, NH2, NHR, etc. CHEBI:14753 CHEBI:25906 CHEBI:7990 KEGG:C00012 Peptide chebi_ontology Peptid Peptide peptido peptidos CHEBI:16670 peptide Peptide KEGG_COMPOUND Peptid ChEBI Peptid chebi Peptide kegg.compound peptido ChEBI peptido chebi peptidos ChEBI peptidos chebi A methylated tertiary amine that is trimethylammonium in which the hydrogen attached to the nitrogen is replaced by a hydroxy group. chebi_ontology (CH3)3NOH hydroxy(trimethyl)azanium hydroxytrimethylazanium CHEBI:166856 hydroxytrimethylaminium (CH3)3NOH chebi hydroxy(trimethyl)azanium iupac hydroxytrimethylazanium iupac An organic cation that is the conjugate acid of noradrenaline, obtained by protonation of the primary amino group; major species at pH 7.3. chebi_ontology 2-(3,4-dihydroxyphenyl)-2-hydroxyethan-1-aminium noradrenaline noradrenaline cation norepinephrine cation norepinephrine(1+) CHEBI:166902 noradrenaline(1+) 2-(3,4-dihydroxyphenyl)-2-hydroxyethan-1-aminium iupac noradrenaline UniProt noradrenaline uniprot_ft noradrenaline cation chebi norepinephrine cation chebi norepinephrine(1+) chebi A ribosyl or deoxyribosyl derivative of a pyrimidine or purine base in which C-5 of the ribose ring is mono-, di-, tri- or tetra-phosphorylated. CHEBI:14674 CHEBI:25603 CHEBI:7650 KEGG:C01117 Nucleoside 5'-phosphate chebi_ontology Nucleoside 5'-phosphate nucleoside 5'-phosphates CHEBI:16701 nucleoside 5'-phosphate Nucleoside 5'-phosphate KEGG_COMPOUND Nucleoside 5'-phosphate kegg.compound nucleoside 5'-phosphates ChEBI nucleoside 5'-phosphates chebi The parent compound of the 6-aminopurines, composed of a purine having an amino group at C-6. CHEBI:13733 CHEBI:22236 CHEBI:2470 CHEBI:40579 DrugBank:DB00173 HMDB:HMDB0000034 KEGG:C00147 KEGG:D00034 KNApSAcK:C00001490 MetaCyc:ADENINE PDBeChem:ADE Wikipedia:Adenine ADENINE Adenine adenine chebi_ontology 6-Aminopurine A ADENINE Ade Adenin Adenine adenine CHEBI:16708 adenine ADENINE PDBeChem Adenine KEGG_COMPOUND adenine UniProt 6-Aminopurine KEGG_COMPOUND 6-Aminopurine kegg.compound A ChEBI A chebi ADENINE pdb-ccd Ade CBN Ade iubmb Adenin NIST_Chemistry_WebBook Adenin nist Adenine kegg.compound adenine uniprot_ft an N-acyl-ethanolamine where the acyl group is a fatty acyl chain with composition not specified, major species at pH 7.3. chebi_ontology an N-(fatty acyl)-ethanolamine CHEBI:167098 N-(fatty acyl)-ethanolamine an N-(fatty acyl)-ethanolamine uniprot_ft A six-carbon aromatic annulene in which each carbon atom donates one of its two 2p electrons into a delocalised pi system. A toxic, flammable liquid byproduct of coal distillation, it is used as an industrial solvent. Benzene is a carcinogen that also damages bone marrow and the central nervous system. A six-carbon aromatic annulene in which each carbon atom donates one of its two 2p electrons into a delocalised π system. A toxic, flammable liquid byproduct of coal distillation, it is used as an industrial solvent. Benzene is a carcinogen that also damages bone marrow and the central nervous system. CHEBI:13876 CHEBI:22703 CHEBI:3025 CHEBI:41187 HMDB:HMDB0001505 KEGG:C01407 PDBeChem:BNZ Wikipedia:Benzene BENZENE Benzene chebi_ontology BENZENE Benzen Benzene Benzine Benzol Bicarburet of hydrogen Coal naphtha Mineral naphtha Phene Pyrobenzol Pyrobenzole [6]annulene benzene benzole cyclohexatriene phenyl hydride CHEBI:16716 benzene BENZENE PDBeChem Benzene KEGG_COMPOUND BENZENE pdb-ccd Benzen IUPAC Benzen iupac Benzene kegg.compound Benzine UM-BBD Benzine umbbd.compound Benzol ChemIDplus Benzol chemidplus Bicarburet of hydrogen ChemIDplus Bicarburet of hydrogen chemidplus Coal naphtha ChemIDplus Coal naphtha chemidplus Mineral naphtha ChemIDplus Mineral naphtha chemidplus Phene ChemIDplus Phene chemidplus Pyrobenzol ChemIDplus Pyrobenzol chemidplus Pyrobenzole ChemIDplus Pyrobenzole chemidplus [6]annulene NIST_Chemistry_WebBook [6]annulene nist benzene chebi uniprot_ft benzole NIST_Chemistry_WebBook benzole nist cyclohexatriene UM-BBD cyclohexatriene umbbd.compound phenyl hydride UM-BBD phenyl hydride umbbd.compound A mineral that is an inorganic nutrient which must be ingested and absorbed in adequate amounts to satisfy a wide range of essential metabolic and/or structural functions in the human body. Wikipedia:Mineral_(nutrient) mineral nutrient mineral nutrients nutrient mineral nutrient minerals CHEBI:167164 mineral nutrient mineral nutrient ChEBI mineral nutrients ChEBI nutrient mineral ChEBI nutrient minerals ChEBI CHEBI:12909 CHEBI:13625 CHEBI:20906 CHEBI:4097 KEGG:C00405 D-alpha-amino acid chebi_ontology D-Amino acid D-alpha-amino acid D-alpha-amino acids CHEBI:16733 D-alpha-amino acid D-alpha-amino acid ChEBI D-Amino acid KEGG_COMPOUND D-Amino acid kegg.compound D-alpha-amino acid chebi D-alpha-amino acids ChEBI D-alpha-amino acids chebi A lactam obtained by formal cyclocondensation of creatine. It is a metabolite of creatine. CHEBI:14029 CHEBI:23406 CHEBI:3910 chebi_ontology 1-Methylglycocyamidine 1-Methylhydantoin-2-imide 1-methylglycocyamidine 2-Amino-1-methylimidazolin-4-one 2-amino-1,5-dihydro-1-methyl-4H-Imidazol-4-one Creatine anhydride Creatinine Kreatinin creatinina creatinine CHEBI:16737 creatinine 1-Methylglycocyamidine kegg.compound 1-Methylhydantoin-2-imide hmdb 1-methylglycocyamidine chebi 2-Amino-1-methylimidazolin-4-one hmdb 2-amino-1,5-dihydro-1-methyl-4H-Imidazol-4-one hmdb Creatine anhydride hmdb Creatinine kegg.compound Kreatinin chebi creatinina chebi creatinine chebi uniprot_ft A pyrimidinemonocarboxylic acid that is uracil bearing a carboxy substituent at position C-6. CHEBI:25720 CHEBI:44781 CHEBI:7787 chebi_ontology OROTIC ACID Orotic acid Orotsaeure Uracil-6-carboxylic acid CHEBI:16742 orotic acid OROTIC ACID pdb-ccd Orotic acid kegg.compound Orotsaeure chebi Uracil-6-carboxylic acid kegg.compound Any oligosaccharide, polysaccharide or their derivatives consisting of monosaccharides or monosaccharide derivatives linked by glycosidic bonds. See also <a href="http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001" target="_blank">http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001</a>. Any oligosaccharide, polysaccharide or their derivatives consisting of monosaccharides or monosaccharide derivatives linked by glycosidic bonds. See also http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001. chebi_ontology glycans CHEBI:167559 glycan glycans ChEBI glycans chebi A purine ribonucleoside 5'-diphosphate having adenine as the nucleobase. CHEBI:13222 CHEBI:22244 CHEBI:2342 CHEBI:40553 COMe:MOL000173 DrugBank:DB03431 KEGG:C00008 KEGG:G11113 KNApSAcK:C00019353 PDBeChem:ADP ADP Adenosine 5'-diphosphate chebi_ontology 5'-adenylphosphoric acid ADENOSINE-5'-DIPHOSPHATE ADP Adenosine 5'-diphosphate H3adp CHEBI:16761 ADP ADP KEGG_COMPOUND Adenosine 5'-diphosphate KEGG_COMPOUND 5'-adenylphosphoric acid ChemIDplus 5'-adenylphosphoric acid chemidplus ADENOSINE-5'-DIPHOSPHATE PDBeChem ADENOSINE-5'-DIPHOSPHATE pdb-ccd ADP kegg.compound Adenosine 5'-diphosphate KEGG_COMPOUND Adenosine 5'-diphosphate kegg.compound H3adp IUPAC H3adp iupac An aminoalkylindole consisting of indole having a 2-aminoethyl group at the 3-position. CHEBI:15274 CHEBI:27161 CHEBI:46157 CHEBI:9767 DrugBank:DB08653 HMDB:HMDB0000303 KEGG:C00398 KNApSAcK:C00001434 MetaCyc:TRYPTAMINE PDBeChem:TSS Wikipedia:Tryptamine 2-(1H-INDOL-3-YL)ETHANAMINE Tryptamine chebi_ontology 1H-indole-3-ethanamine 2-(1H-INDOL-3-YL)ETHANAMINE 2-(3-indolyl)ethylamine 3-(2-Aminoethyl)indole Tryptamine CHEBI:16765 tryptamine 2-(1H-INDOL-3-YL)ETHANAMINE PDBeChem Tryptamine KEGG_COMPOUND 1H-indole-3-ethanamine NIST_Chemistry_WebBook 1H-indole-3-ethanamine nist 2-(1H-INDOL-3-YL)ETHANAMINE PDBeChem 2-(1H-INDOL-3-YL)ETHANAMINE pdb-ccd 2-(3-indolyl)ethylamine ChemIDplus 2-(3-indolyl)ethylamine chemidplus 3-(2-Aminoethyl)indole KEGG_COMPOUND 3-(2-Aminoethyl)indole kegg.compound Tryptamine kegg.compound A member of the class of acetamides that is acetamide in which one of the hydrogens attached to the nitrogen atom is replaced by a 2-(5-methoxy-1H-indol-3-yl)ethyl group. It is a hormone secreted by the pineal gland in humans. CHEBI:14577 CHEBI:25180 CHEBI:6730 DrugBank:DB01065 HMDB:HMDB0001389 KEGG:C01598 KEGG:D08170 LINCS:LSM-4779 MetaCyc:N-ACETYL-5-METHOXY-TRYPTAMINE PDBeChem:ML1 Wikipedia:Melatonin Melatonin melatonin 5-methoxy-N-acetyltryptamine N-Acetyl-5-methoxytryptamine N-[2-(5-methoxyindol-3-yl)ethyl]acetamide melatonine CHEBI:16796 melatonin Melatonin KEGG_COMPOUND melatonin UniProt 5-methoxy-N-acetyltryptamine ChemIDplus N-Acetyl-5-methoxytryptamine KEGG_COMPOUND N-[2-(5-methoxyindol-3-yl)ethyl]acetamide NIST_Chemistry_WebBook melatonine ChEBI A sulfur-containing amino acid that is butyric acid bearing an amino substituent at position 2 and a methylthio substituent at position 4. CHEBI:14590 CHEBI:25229 CHEBI:6829 Methionine chebi_ontology 2-Amino-4-(methylthio)butyric acid 2-amino-4-(methylsulfanyl)butanoic acid 2-amino-4-(methylthio)butanoic acid DL-Methionine Hmet M Met Methionin Methionine Racemethionine alpha-amino-gamma-methylmercaptobutyric acid methionine metionina CHEBI:16811 methionine Methionine KEGG_COMPOUND 2-Amino-4-(methylthio)butyric acid kegg.compound 2-amino-4-(methylsulfanyl)butanoic acid iupac 2-amino-4-(methylthio)butanoic acid jcbn DL-Methionine kegg.drug Hmet iupac M chebi Met chebi Methionin chebi Methionine kegg.compound Racemethionine kegg.drug alpha-amino-gamma-methylmercaptobutyric acid nist methionine chebi metionina chebi A 21-hydroxy steroid that consists of pregn-4-ene substituted by hydroxy groups at positions 11 and 21 and oxo groups at positions 3 and 20. Corticosterone is a 21-carbon steroid hormone of the corticosteroid type produced in the cortex of the adrenal glands. CHEBI:14022 CHEBI:19131 CHEBI:3891 CHEBI:41361 CHEBI:57911 chebi_ontology (11beta)-11,21-dihydroxypregn-4-ene-3,20-dione 11beta,21-Dihydroxy-4-pregnene-3,20-dione 11beta,21-dihydroxyprogesterone 17-deoxycortisol CORTICOSTERONE Corticosterone Kendall's compound B Reichstein's substance H corticosterone CHEBI:16827 corticosterone (11beta)-11,21-dihydroxypregn-4-ene-3,20-dione nist 11beta,21-Dihydroxy-4-pregnene-3,20-dione kegg.compound 11beta,21-dihydroxyprogesterone nist 17-deoxycortisol chemidplus CORTICOSTERONE pdb-ccd Corticosterone kegg.compound Kendall's compound B kegg.compound Reichstein's substance H kegg.compound corticosterone uniprot_ft A tripeptide compound consisting of glutamic acid attached via its side chain to the N-terminus of cysteinylglycine. CHEBI:12402 CHEBI:14327 CHEBI:24334 CHEBI:42873 CHEBI:43049 CHEBI:5437 chebi_ontology 5-L-Glutamyl-L-cysteinylglycine GSH Glutathione Glutathione-SH N-(N-gamma-L-Glutamyl-L-cysteinyl)glycine Reduced glutathione gamma-L-Glutamyl-L-cysteinyl-glycine CHEBI:16856 glutathione 5-L-Glutamyl-L-cysteinylglycine kegg.compound GSH kegg.compound Glutathione kegg.compound Glutathione-SH hmdb N-(N-gamma-L-Glutamyl-L-cysteinyl)glycine kegg.compound Reduced glutathione kegg.compound gamma-L-Glutamyl-L-cysteinyl-glycine kegg.compound CHEBI:13401 CHEBI:13662 CHEBI:14675 CHEBI:18181 CHEBI:25606 CHEBI:7428 CHEBI:7652 KEGG:C00454 chebi_ontology NDP Nucleoside diphosphate nucleoside diphosphates CHEBI:16862 nucleoside 5'-diphosphate NDP KEGG_COMPOUND NDP kegg.compound Nucleoside diphosphate KEGG_COMPOUND Nucleoside diphosphate kegg.compound nucleoside diphosphates ChEBI nucleoside diphosphates chebi A gamma-amino acid that is butanoic acid with the amino substituent located at C-4. A γ-amino acid that is butanoic acid with the amino substituent located at C-4. CHEBI:1786 CHEBI:193777 CHEBI:20318 CHEBI:40483 BPDB:2298 DrugBank:DB02530 HMDB:HMDB0000112 KEGG:C00334 KEGG:D00058 KNApSAcK:C00001337 MetaCyc:4-AMINO-BUTYRATE PDBeChem:ABU Wikipedia:Gamma-Aminobutyric_acid 4-Aminobutanoic acid 4-aminobutanoic acid gamma-Aminobutyric acid gamma-aminobutyric acid chebi_ontology 4-Aminobutanoic acid 4-Aminobutyric acid 4-aminobutanoic acid 4-aminobutyric acid 4Abu GABA GAMMA-AMINO-BUTANOIC ACID gamma-Aminobuttersaeure gamma-Aminobutyric acid gamma-amino-n-butyric acid gamma-aminobutanoic acid gamma-aminobutyric acid omega-aminobutyric acid piperidic acid piperidinic acid CHEBI:16865 gamma-aminobutyric acid 4-Aminobutanoic acid KEGG_COMPOUND 4-aminobutanoic acid ChEBI gamma-Aminobutyric acid KEGG_COMPOUND gamma-aminobutyric acid NIST_Chemistry_WebBook 4-Aminobutanoic acid KEGG_COMPOUND 4-Aminobutanoic acid kegg.compound 4-Aminobutyric acid KEGG_COMPOUND 4-Aminobutyric acid kegg.compound 4-aminobutanoic acid ChEBI 4-aminobutanoic acid chebi 4-aminobutyric acid ChEBI 4-aminobutyric acid chebi 4Abu ChEBI 4Abu chebi GABA IUPHAR KEGG_COMPOUND GABA iuphar kegg.compound GAMMA-AMINO-BUTANOIC ACID PDBeChem GAMMA-AMINO-BUTANOIC ACID pdb-ccd gamma-Aminobuttersaeure NIST_Chemistry_WebBook gamma-Aminobuttersaeure nist gamma-Aminobutyric acid kegg.compound gamma-amino-n-butyric acid NIST_Chemistry_WebBook gamma-amino-n-butyric acid nist gamma-aminobutanoic acid NIST_Chemistry_WebBook gamma-aminobutanoic acid nist gamma-aminobutyric acid nist omega-aminobutyric acid NIST_Chemistry_WebBook omega-aminobutyric acid nist piperidic acid ChemIDplus piperidic acid chemidplus piperidinic acid ChemIDplus piperidinic acid chemidplus A glycine derivative having methyl and amidino groups attached to the nitrogen. CHEBI:14028 CHEBI:23404 CHEBI:3909 CHEBI:41678 chebi_ontology ((amino(imino)methyl)(methyl)amino)acetic acid (N-methylcarbamimidamido)acetic acid (alpha-methylguanido)acetic acid Creatin Creatine Kreatin Methylglycocyamine N-(aminoiminomethyl)-N-methylglycine N-Methyl-N-guanylglycine N-[(E)-AMINO(IMINO)METHYL]-N-METHYLGLYCINE N-amidinosarcosine N-carbamimidoyl-N-methylglycine N-methyl-N-guanylglycine alpha-Methylguanidino acetic acid CHEBI:16919 creatine ((amino(imino)methyl)(methyl)amino)acetic acid hmdb (N-methylcarbamimidamido)acetic acid chebi (alpha-methylguanido)acetic acid hmdb nist Creatin chemidplus Creatine kegg.compound Kreatin chemidplus Methylglycocyamine kegg.compound N-(aminoiminomethyl)-N-methylglycine nist N-Methyl-N-guanylglycine hmdb N-[(E)-AMINO(IMINO)METHYL]-N-METHYLGLYCINE pdb-ccd N-amidinosarcosine chemidplus N-carbamimidoyl-N-methylglycine pdb-ccd N-methyl-N-guanylglycine chemidplus alpha-Methylguanidino acetic acid kegg.compound A tricarboxylic acid trianion, obtained by deprotonation of the three carboxy groups of citric acid. CHEBI:13999 CHEBI:23321 CHEBI:42563 chebi_ontology 2-hydroxy-1,2,3-propanetricarboxylate 2-hydroxy-1,2,3-propanetricarboxylate(3-) 2-hydroxy-1,2,3-propanetricarboxylic acid, ion(3-) 2-hydroxytricarballylate CITRATE ANION cit cit(3-) citrate CHEBI:16947 citrate(3-) 2-hydroxy-1,2,3-propanetricarboxylate chebi 2-hydroxy-1,2,3-propanetricarboxylate(3-) chemidplus 2-hydroxy-1,2,3-propanetricarboxylic acid, ion(3-) chemidplus 2-hydroxytricarballylate chebi CITRATE ANION pdb-ccd cit iupac cit(3-) chebi citrate uniprot_ft A doubly-charged <em>N</em>-acyl-<small>L</small>-α-amino acid anion resulting from deprotonation of both carboxy groups of <em>N</em>-acetyl-<small>L</small>-aspartic acid. CHEBI:12574 CHEBI:21546 CHEBI:7149 CHEBI:87271 chebi_ontology (S)-2-(acetylamino)succinate N-Acetyl-L-aspartate N-acetyl-L-aspartate CHEBI:16953 N-acetyl-L-aspartate(2-) (S)-2-(acetylamino)succinate chebi N-Acetyl-L-aspartate kegg.compound N-acetyl-L-aspartate uniprot_ft A naturally-occurring β-amino acid comprising propionic acid with the amino group in the 3-position. CHEBI:10343 CHEBI:12389 CHEBI:22821 CHEBI:41050 BETA-ALANINE beta-Alanine chebi_ontology 3-Aminopropionic acid 3-aminopropanoic acid BETA-ALANINE H-beta-Ala-OH bAla beta-Alanine beta-aminopropionic acid omega-aminopropionic acid CHEBI:16958 beta-alanine BETA-ALANINE PDBeChem beta-Alanine KEGG_COMPOUND 3-Aminopropionic acid kegg.compound 3-aminopropanoic acid chebi BETA-ALANINE pdb-ccd H-beta-Ala-OH chebi bAla chebi beta-Alanine kegg.compound beta-aminopropionic acid nist omega-aminopropionic acid chebi A mineralocorticoid that is progesterone substituted at position 21 by a hydroxy group. CHEBI:11314 CHEBI:19123 CHEBI:39642 CHEBI:713 CHEBI:86536 chebi_ontology 11-Deoxycorticosterone 21-Hydroxy-4-pregnene-3,20-dione 21-hydroxyprogesterone 4-pregnen-21-ol-3,20-dione Cortexone DESOXYCORTICOSTERONE DOC Deoxycorticosterone Desoxycortone Kendall's desoxy compound B Reichstein's substance Q desoxycortone CHEBI:16973 11-deoxycorticosterone 11-Deoxycorticosterone kegg.compound 21-Hydroxy-4-pregnene-3,20-dione kegg.compound 21-hydroxyprogesterone chemidplus uniprot_ft 4-pregnen-21-ol-3,20-dione chemidplus Cortexone kegg.compound DESOXYCORTICOSTERONE pdb-ccd DOC kegg.compound Deoxycorticosterone kegg.compound Desoxycortone kegg.compound Kendall's desoxy compound B chemidplus Reichstein's substance Q nist desoxycortone chemidplus A ribose in which the chiral carbon atom furthest away from the aldehyde group (C4') has the same configuration as in <small>D</small>-glyceraldehyde. A ribose in which the chiral carbon atom furthest away from the aldehyde group (C4') has the same configuration as in D-glyceraldehyde. CHEBI:13011 CHEBI:21078 DrugBank:DB01936 chebi_ontology D-Rib CHEBI:16988 D-ribose D-Rib JCBN D-Rib jcbn A member of the class of biladienes that is a linear tetrapyrrole with the dipyrrole units being of both exovinyl and endovinyl type. A product of heme degradation, it is produced in the reticuloendothelial system by the reduction of biliverdin and transported to the liver as a complex with serum albumin. CHEBI:13898 CHEBI:22870 CHEBI:3099 HMDB:HMDB0000054 KEGG:C00486 KNApSAcK:C00029828 MetaCyc:BILIRUBIN PDBeChem:BLR Wikipedia:Bilirubin Bilirubin chebi_ontology 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid 8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione Bilirubin bilirubin(Z,Z) bilirubin-IXalpha CHEBI:16990 bilirubin IXalpha Bilirubin KEGG_COMPOUND 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid ChemIDplus 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid chemidplus 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid ChemIDplus 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid chemidplus 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid IUPAC 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid iupac 8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione JCBN 8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione jcbn Bilirubin KEGG_COMPOUND Bilirubin kegg.compound bilirubin(Z,Z) ChEBI bilirubin(Z,Z) chebi bilirubin-IXalpha ChEBI bilirubin-IXalpha chebi High molecular weight, linear polymers, composed of nucleotides containing deoxyribose and linked by phosphodiester bonds; DNA contain the genetic information of organisms. CHEBI:13302 CHEBI:21123 CHEBI:33698 CHEBI:4291 KEGG:C00039 Deoxyribonucleic acid (Deoxyribonucleotide)m (Deoxyribonucleotide)n (Deoxyribonucleotide)n+m DNA DNAn DNAn+1 DNS Desoxyribonukleinsaeure deoxyribonucleic acids desoxyribose nucleic acid thymus nucleic acid CHEBI:16991 deoxyribonucleic acid Deoxyribonucleic acid KEGG_COMPOUND (Deoxyribonucleotide)m KEGG_COMPOUND (Deoxyribonucleotide)n KEGG_COMPOUND (Deoxyribonucleotide)n+m KEGG_COMPOUND DNA IUPAC KEGG_COMPOUND UniProt DNAn KEGG_COMPOUND DNAn+1 KEGG_COMPOUND DNS ChEBI Desoxyribonukleinsaeure ChEBI deoxyribonucleic acids ChEBI desoxyribose nucleic acid ChemIDplus thymus nucleic acid ChEBI An α,ω-dicarboxylic acid that is ethane substituted by carboxyl groups at positions 1 and 2. CHEBI:25730 CHEBI:44583 CHEBI:7811 OXALIC ACID Oxalic acid chebi_ontology Ethandisaeure Ethanedioic acid H2ox HOOCCOOH OXALIC ACID Oxalic acid Oxalsaeure ethane-1,2-dioic acid CHEBI:16995 oxalic acid OXALIC ACID PDBeChem Oxalic acid KEGG_COMPOUND Ethandisaeure chebi Ethanedioic acid kegg.compound H2ox iupac HOOCCOOH nist OXALIC ACID pdb-ccd Oxalic acid kegg.compound Oxalsaeure chebi ethane-1,2-dioic acid nist The D-enantiomer of phenylalanine. CHEBI:13007 CHEBI:21067 CHEBI:42207 CHEBI:4224 DrugBank:DB02556 ECMDB:ECMDB20144 KEGG:C02265 MetaCyc:CPD-216 PDBeChem:DPN YMDB:YMDB00995 D-PHENYLALANINE D-Phenylalanine D-Phe D-alpha-Amino-beta-phenylpropionic acid DPN phenylalanine D-form CHEBI:16998 D-phenylalanine D-PHENYLALANINE PDBeChem D-Phenylalanine KEGG_COMPOUND D-Phe ChEBI D-alpha-Amino-beta-phenylpropionic acid KEGG_COMPOUND DPN PDBeChem phenylalanine D-form ChemIDplus A C21-steroid hormone in which a pregnane skeleton carries oxo substituents at positions 3 and 20 and is unsaturated at C(4)-C(5). As a hormone, it is involved in the female menstrual cycle, pregnancy and embryogenesis of humans and other species. A C<small>₂₁</small>-steroid hormone in which a pregnane skeleton carries oxo substituents at positions 3 and 20 and is unsaturated at C(4)-C(5). As a hormone, it is involved in the female menstrual cycle, pregnancy and embryogenesis of humans and other species. CHEBI:14896 CHEBI:18798 CHEBI:26269 CHEBI:28589 CHEBI:439 CHEBI:45786 CHEBI:8453 DrugBank:DB00396 HMDB:HMDB0001830 KEGG:C00410 KEGG:D00066 MetaCyc:PROGESTERONE PDBeChem:STR Wikipedia:Progesterone PROGESTERONE Progesterone progesterone chebi_ontology (S)-4-Pregnene-3,20-dione (S)-Pregn-4-en-3,20-dione (S)-Progesterone 17alpha-progesterone 4-Pregnene-3,20-dione Agolutin Akrolutin Crinone Delta(4)-pregnene-3,20-dione Gelbkoerperhormon PROGESTERONE Progesteron Progesterone corpus luteum hormone luteohormone progesterone CHEBI:17026 progesterone PROGESTERONE PDBeChem Progesterone KEGG_COMPOUND progesterone UniProt (S)-4-Pregnene-3,20-dione KEGG_COMPOUND (S)-4-Pregnene-3,20-dione kegg.compound (S)-Pregn-4-en-3,20-dione KEGG_COMPOUND (S)-Pregn-4-en-3,20-dione kegg.compound (S)-Progesterone KEGG_COMPOUND (S)-Progesterone kegg.compound 17alpha-progesterone NIST_Chemistry_WebBook 17alpha-progesterone nist 4-Pregnene-3,20-dione KEGG_COMPOUND 4-Pregnene-3,20-dione kegg.compound Agolutin NIST_Chemistry_WebBook Agolutin nist Akrolutin ChEBI Akrolutin chebi Crinone ChemIDplus Crinone chemidplus Delta(4)-pregnene-3,20-dione ChEBI Delta(4)-pregnene-3,20-dione chebi Gelbkoerperhormon ChEBI Gelbkoerperhormon chebi PROGESTERONE pdb-ccd Progesteron ChEBI Progesteron chebi Progesterone kegg.compound corpus luteum hormone ChemIDplus corpus luteum hormone chemidplus luteohormone ChemIDplus luteohormone chemidplus progesterone uniprot_ft The <small>L</small>-enantiomer of aspartic acid. CHEBI:21247 CHEBI:40853 CHEBI:40900 CHEBI:40913 CHEBI:40942 CHEBI:6193 ASPARTIC ACID L-Aspartic acid chebi_ontology (S)-2-aminobutanedioic acid (S)-2-aminosuccinic acid 2-Aminosuccinic acid ASPARTIC ACID Asp D L-Asparaginsaeure L-Aspartic acid CHEBI:17053 L-aspartic acid ASPARTIC ACID PDBeChem L-Aspartic acid KEGG_COMPOUND (S)-2-aminobutanedioic acid chebi (S)-2-aminosuccinic acid chebi 2-Aminosuccinic acid kegg.compound ASPARTIC ACID pdb-ccd Asp chebi D chebi L-Asparaginsaeure chebi L-Aspartic acid kegg.compound CHEBI:13431 CHEBI:8749 chebi_ontology RCH2NH2 primary aliphatic amines CHEBI:17062 primary aliphatic amine RCH2NH2 chebi kegg.compound primary aliphatic amines chebi A compound in which a carbonyl group is bonded to two carbon atoms: R2C=O (neither R may be H). A compound in which a carbonyl group is bonded to two carbon atoms: R<small>₂</small>C=O (neither R may be H). CHEBI:13427 CHEBI:13646 CHEBI:24974 CHEBI:6127 CHEBI:8742 KEGG:C01450 Wikipedia:Ketone Ketone ketones chebi_ontology Keton Ketone R-CO-R' a ketone cetone ketones CHEBI:17087 ketone Ketone KEGG_COMPOUND ketones ChEBI Keton ChEBI Keton chebi Ketone kegg.compound R-CO-R' KEGG_COMPOUND R-CO-R' kegg.compound a ketone UniProt a ketone uniprot_ft cetone ChEBI cetone chebi ketones ChEBI ketones chebi A compound in which a carbohydrate component is covalently bound to a protein component. CHEBI:14349 CHEBI:5481 CHEBI:5493 KEGG:C00326 Glycoprotein chebi_ontology Glycoprotein Glykoprotein Glykoproteine a glycoprotein glicoproteina glicoproteinas glycoproteine glycoproteines CHEBI:17089 glycoprotein Glycoprotein KEGG_COMPOUND Glycoprotein kegg.compound Glykoprotein ChEBI Glykoprotein chebi Glykoproteine ChEBI Glykoproteine chebi a glycoprotein UniProt a glycoprotein uniprot_ft glicoproteina ChEBI glicoproteina chebi glicoproteinas ChEBI glicoproteinas chebi glycoproteine ChEBI glycoproteine chebi glycoproteines ChEBI glycoproteines chebi A short-chain fatty acid anion that is the conjugate base of hexanoic acid (also known as caproic acid). CHEBI:14398 CHEBI:24569 chebi_ontology 1-hexanoate 1-pentacarboxylate 1-pentanecarboxylate CH3-[CH2]4-COO(-) butylacetate caproate capronate hexanoate hexoate hexylate n-caproate n-hexanoate n-hexoate n-hexylate nPnCO2 anion pentanecarboxylate pentylformate CHEBI:17120 hexanoate 1-hexanoate chebi 1-pentacarboxylate chebi 1-pentanecarboxylate chebi CH3-[CH2]4-COO(-) iupac butylacetate chebi caproate chebi capronate chebi hexanoate uniprot_ft hexoate chebi hexylate chebi n-caproate chebi n-hexanoate chebi n-hexoate chebi n-hexylate chebi nPnCO2 anion nist pentanecarboxylate chebi pentylformate chebi An amino-acid betaine that is butanoate substituted with a hydroxy group at position C-3 and a trimethylammonium group at C-4. CHEBI:11817 CHEBI:13947 CHEBI:20047 CHEBI:23038 CHEBI:29085 chebi_ontology D,L-carnitine carnitine CHEBI:17126 carnitine D,L-carnitine metacyc.compound carnitine uniprot_ft CHEBI:13367 CHEBI:5598 chebi_ontology Bisulfite HSO3(-) HSO3- Hydrogen sulfite [SO2(OH)](-) bisulfite bisulphite hydrogen sulfite(1-) hydrosulfite anion CHEBI:17137 hydrogensulfite Bisulfite kegg.compound HSO3(-) iupac HSO3- kegg.compound Hydrogen sulfite kegg.compound [SO2(OH)](-) iupac bisulfite chemidplus bisulphite chemidplus hydrogen sulfite(1-) chemidplus hydrosulfite anion chemidplus Any 3β-hydroxy-steroid that contains a double bond between positions 5 and 6. CHEBI:13608 CHEBI:136845 CHEBI:20245 chebi_ontology 3beta-hydroxy Delta(5)-steroids 3beta-hydroxy-Delta(5)-steroids a 3-beta-hydroxy-Delta(5)-steroid CHEBI:1722 3beta-hydroxy-Delta(5)-steroid 3beta-hydroxy Delta(5)-steroids chebi 3beta-hydroxy-Delta(5)-steroids chebi a 3-beta-hydroxy-Delta(5)-steroid uniprot_ft A sulfur-containing amino acid consisting of a glycine core with a 2-mercaptoethyl side-chain. CHEBI:14408 CHEBI:5751 Homocysteine chebi_ontology 2-Amino-4-mercaptobutyric acid Hcy Homocysteine CHEBI:17230 homocysteine Homocysteine KEGG_COMPOUND 2-Amino-4-mercaptobutyric acid kegg.compound Hcy iupac Homocysteine kegg.compound An aldohexose used as a source of energy and metabolic intermediate. CHEBI:14313 CHEBI:24277 CHEBI:33929 CHEBI:5418 KEGG:C00293 Wikipedia:Glucose Glucose chebi_ontology DL-glucose Glc Glucose Glukose CHEBI:17234 glucose Glucose KEGG_COMPOUND DL-glucose ChEBI DL-glucose chebi Glc JCBN Glc jcbn Glucose kegg.compound Glukose ChEBI Glukose chebi The 7<em>H</em>-tautomer of purine. The 7H-tautomer of purine. CHEBI:14968 CHEBI:8639 HMDB:HMDB0001366 KEGG:C15587 Purine chebi_ontology Purine Purine base CHEBI:17258 7H-purine Purine KEGG_COMPOUND Purine KEGG_COMPOUND Purine kegg.compound Purine base KEGG_COMPOUND Purine base kegg.compound The conjugate base of propionic acid; a key precursor in lipid biosynthesis. CHEBI:14903 CHEBI:26290 KEGG:C00163 propionate chebi_ontology CH3-CH2-COO(-) EtCO2 anion carboxylatoethane ethanecarboxylate ethylformate metacetonate methylacetate propanate propanoate propanoic acid, ion(1-) propionate pseudoacetate CHEBI:17272 propionate propionate IUPAC CH3-CH2-COO(-) IUPAC CH3-CH2-COO(-) iupac EtCO2 anion NIST_Chemistry_WebBook EtCO2 anion nist carboxylatoethane ChEBI carboxylatoethane chebi ethanecarboxylate ChEBI ethanecarboxylate chebi ethylformate ChEBI ethylformate chebi metacetonate ChEBI metacetonate chebi methylacetate ChEBI methylacetate chebi propanate ChEBI propanate chebi propanoate UniProt propanoate uniprot_ft propanoic acid, ion(1-) ChemIDplus propanoic acid, ion(1-) chemidplus propionate iupac pseudoacetate ChEBI pseudoacetate chebi The L-enantiomer of phenylalanine. CHEBI:13151 CHEBI:21370 CHEBI:44851 CHEBI:44885 CHEBI:45079 CHEBI:6282 DrugBank:DB00120 ECMDB:ECMDB00159 HMDB:HMDB0000159 KEGG:C00079 KEGG:D00021 KNApSAcK:C00001386 MetaCyc:PHE PDBeChem:PHE Wikipedia:Phenylalanine YMDB:YMDB00304 L-Phenylalanine (S)-2-Amino-3-phenylpropionic acid (S)-alpha-Amino-beta-phenylpropionic acid 3-phenyl-L-alanine F PHENYLALANINE Phe beta-phenyl-L-alanine CHEBI:17295 L-phenylalanine L-Phenylalanine KEGG_COMPOUND (S)-2-Amino-3-phenylpropionic acid HMDB (S)-alpha-Amino-beta-phenylpropionic acid KEGG_COMPOUND 3-phenyl-L-alanine NIST_Chemistry_WebBook F ChEBI PHENYLALANINE PDBeChem Phe ChEBI beta-phenyl-L-alanine NIST_Chemistry_WebBook Any substance that induces or promotes ferroptosis (a type of programmed cell death dependent on iron and characterized by the accumulation of lipid peroxides) in organisms. Wikipedia:Ferroptosis chebi_ontology ferroptosis inducers CHEBI:173085 ferroptosis inducer ferroptosis inducers ChEBI ferroptosis inducers chebi CHEBI:13411 CHEBI:14677 CHEBI:17035 CHEBI:25610 CHEBI:7442 CHEBI:7655 KEGG:C00201 chebi_ontology NTP Nucleoside triphosphate nucleoside triphosphates CHEBI:17326 nucleoside 5'-triphoshate NTP KEGG_COMPOUND NTP kegg.compound Nucleoside triphosphate KEGG_COMPOUND Nucleoside triphosphate kegg.compound nucleoside triphosphates ChEBI nucleoside triphosphates chebi An androstanoid having 17beta-hydroxy and 3-oxo groups, together with unsaturation at C-4-C-5.. An androstanoid having 17β-hydroxy and 3-oxo groups, together with unsaturation at C-4‒C-5.. CHEBI:15214 CHEBI:26883 CHEBI:45798 CHEBI:9461 DrugBank:DB00624 HMDB:HMDB0000234 KEGG:C00535 KEGG:D00075 KNApSAcK:C00003675 PDBeChem:TES Wikipedia:Testosterone TESTOSTERONE Testosterone testosterone chebi_ontology 17beta-Hydroxy-4-androsten-3-one 17beta-hydroxy-4-androsten-3-one 4-androsten-17beta-ol-3-one Androderm TESTOSTERONE Testosteron Testosterone testosterone CHEBI:17347 testosterone TESTOSTERONE PDBeChem Testosterone KEGG_COMPOUND testosterone UniProt 17beta-Hydroxy-4-androsten-3-one KEGG_COMPOUND 17beta-Hydroxy-4-androsten-3-one kegg.compound 17beta-hydroxy-4-androsten-3-one ChEBI 17beta-hydroxy-4-androsten-3-one chebi 4-androsten-17beta-ol-3-one NIST_Chemistry_WebBook 4-androsten-17beta-ol-3-one nist Androderm ChemIDplus Androderm chemidplus TESTOSTERONE pdb-ccd Testosteron ChemIDplus Testosteron chemidplus Testosterone kegg.compound testosterone uniprot_ft A sulfur oxoanion that is the conjugate base of hydrogen sulfite (H<small>₂</small>SO<small>₃</small>). CHEBI:15139 CHEBI:45548 chebi_ontology SO3 SO3(2-) SULFITE ION [SO3](2-) sulfite sulphite CHEBI:17359 sulfite SO3 chebi SO3(2-) iupac SULFITE ION pdb-ccd [SO3](2-) iupac sulfite uniprot_ft sulphite chebi The <small>D</small>-enantiomer of aspartic acid. CHEBI:20920 CHEBI:4108 D-Aspartic acid chebi_ontology (R)-2-aminobutanedioic acid (R)-2-aminosuccinic acid D-Asparaginsaeure D-Aspartic acid DAS aspartic acid D-form CHEBI:17364 D-aspartic acid D-Aspartic acid KEGG_COMPOUND (R)-2-aminobutanedioic acid chebi (R)-2-aminosuccinic acid chebi D-Asparaginsaeure chebi D-Aspartic acid kegg.compound DAS pdb-ccd aspartic acid D-form chemidplus A 2-hydroxy monocarboxylic acid in which the carbon at position 2 has (<i>S</i>)-configuration. CHEBI:11031 CHEBI:18737 CHEBI:378 CHEBI:381 chebi_ontology (2S)-2-hydroxy monocarboxylic acids (S)-2-Hydroxy acid (S)-2-Hydroxyalkanoic acid (S)-2-Hydroxycarboxylic acid (S)-2-Hydroxymonocarboxylic acid CHEBI:17375 (2S)-2-hydroxy monocarboxylic acid (2S)-2-hydroxy monocarboxylic acids chebi (S)-2-Hydroxy acid kegg.compound (S)-2-Hydroxyalkanoic acid kegg.compound (S)-2-Hydroxycarboxylic acid kegg.compound (S)-2-Hydroxymonocarboxylic acid kegg.compound A sulfur-containing amino acid obtained by the oxidation of two cysteine molecules which are then linked via a disulfide bond. CHEBI:14062 CHEBI:23513 CHEBI:4052 Cystine chebi_ontology 3,3'-dithiobis(2-aminopropanoic acid) Cystin Cystine Dicysteine Zystin alpha-Diamino-beta-dithiolactic acid cistina CHEBI:17376 cystine Cystine KEGG_COMPOUND 3,3'-dithiobis(2-aminopropanoic acid) chebi Cystin chebi Cystine kegg.compound Dicysteine kegg.compound Zystin chebi alpha-Diamino-beta-dithiolactic acid kegg.compound cistina chebi A straight-chain saturated fatty acid containing five carbon atoms. CHEBI:113448 CHEBI:27263 CHEBI:27264 CHEBI:43606 CHEBI:44803 CHEBI:7980 PENTANOIC ACID Pentanoate Pentanoic acid chebi_ontology 1-butanecarboxylic acid CH3-[CH2]3-COOH PENTANOIC ACID Pentanoate Pentanoic acid Valerate Valerianic acid Valeriansaeure Valeric acid n-BuCOOH n-Pentanoate n-Valeric acid n-pentanoic acid n-valeric acid pentoic acid propylacetic acid valeric acid, normal CHEBI:17418 valeric acid PENTANOIC ACID PDBeChem Pentanoate KEGG_COMPOUND Pentanoic acid KEGG_COMPOUND 1-butanecarboxylic acid chemidplus nist CH3-[CH2]3-COOH iupac PENTANOIC ACID pdb-ccd Pentanoate kegg.compound Pentanoic acid kegg.compound Valerate kegg.compound Valerianic acid kegg.compound Valeriansaeure chebi Valeric acid kegg.compound n-BuCOOH chebi n-Pentanoate kegg.compound n-Valeric acid kegg.compound n-pentanoic acid chemidplus n-valeric acid chemidplus pentoic acid chebi propylacetic acid chemidplus valeric acid, normal chemidplus A C<small>₄</small>-dicarboxylate resulting from the removal of a proton from both carboxylic acid groups of methylmalonic acid. CHEBI:14603 CHEBI:25317 chebi_ontology methylmalonate methylmalonate dianion CHEBI:17453 methylmalonate(2-) methylmalonate uniprot_ft methylmalonate dianion chebi A compound RC(=O)H, in which a carbonyl group is bonded to one hydrogen atom and to one R group. CHEBI:13432 CHEBI:13753 CHEBI:13805 CHEBI:13806 CHEBI:17496 CHEBI:22291 CHEBI:2554 CHEBI:8750 KEGG:C00071 Aldehyde chebi_ontology Aldehyd Aldehyde RC(=O)H RCHO aldehido aldehidos aldehyde aldehydes aldehydum an aldehyde CHEBI:17478 aldehyde Aldehyde KEGG_COMPOUND Aldehyd ChEBI Aldehyd chebi Aldehyde kegg.compound RC(=O)H IUPAC RC(=O)H iupac RCHO KEGG_COMPOUND RCHO kegg.compound aldehido ChEBI aldehido chebi aldehidos ChEBI aldehidos chebi aldehyde chebi aldehydes ChEBI aldehydes chebi aldehydum ChEBI aldehydum chebi an aldehyde UniProt an aldehyde uniprot_ft A carbohydrate that is an acyclic polyol having the general formula HOCH<small>₂</small>[CH(OH)]<small>_<em>n</em></small>CH<small>₂</small>OH (formally derivable from an aldose by reduction of the carbonyl group). CHEBI:13754 CHEBI:22298 CHEBI:2556 chebi_ontology Alditol Glycitol Sugar alcohol alditol alditols CHEBI:17522 alditol Alditol kegg.compound Glycitol kegg.compound Sugar alcohol kegg.compound alditol uniprot_ft alditols chebi The carbon oxoanion resulting from the removal of a proton from carbonic acid. CHEBI:13363 CHEBI:22863 CHEBI:40961 CHEBI:5589 HMDB:HMDB0000595 KEGG:C00288 MetaCyc:HCO3 PDBeChem:BCT Wikipedia:Bicarbonate Hydrogencarbonate chebi_ontology Acid carbonate BICARBONATE ION Bicarbonate HCO3(-) HCO3- Hydrogencarbonate [CO2(OH)](-) hydrogen carbonate hydrogencarbonate CHEBI:17544 hydrogencarbonate Hydrogencarbonate KEGG_COMPOUND Acid carbonate KEGG_COMPOUND Acid carbonate kegg.compound BICARBONATE ION PDBeChem BICARBONATE ION pdb-ccd Bicarbonate KEGG_COMPOUND Bicarbonate kegg.compound HCO3(-) IUPAC HCO3(-) iupac HCO3- KEGG_COMPOUND HCO3- kegg.compound Hydrogencarbonate kegg.compound [CO2(OH)](-) IUPAC [CO2(OH)](-) iupac hydrogen carbonate PDBeChem hydrogen carbonate pdb-ccd hydrogencarbonate uniprot_ft An optically active form of cysteine having <small>L</small>-configuration. CHEBI:13095 CHEBI:21261 CHEBI:41227 CHEBI:41700 CHEBI:41768 CHEBI:41781 CHEBI:41811 CHEBI:6207 CYSTEINE L-Cysteine chebi_ontology (2R)-2-amino-3-mercaptopropanoic acid (2R)-2-amino-3-sulfanylpropanoic acid (R)-2-amino-3-mercaptopropanoic acid C CYSTEINE Cys E 920 E-920 E920 FREE CYSTEINE L-2-Amino-3-mercaptopropionic acid L-Cystein L-Cysteine L-Zystein CHEBI:17561 L-cysteine CYSTEINE PDBeChem L-Cysteine KEGG_COMPOUND (2R)-2-amino-3-mercaptopropanoic acid jcbn (2R)-2-amino-3-sulfanylpropanoic acid iupac (R)-2-amino-3-mercaptopropanoic acid nist C chebi CYSTEINE pdb-ccd Cys chebi E 920 chebi E-920 chebi E920 chebi FREE CYSTEINE pdb-ccd L-2-Amino-3-mercaptopropionic acid kegg.compound L-Cystein chebi L-Cysteine kegg.compound L-Zystein chebi A common and naturally occurring pyrimidine nucleobase in which the pyrimidine ring is substituted with two oxo groups at positions 2 and 4. Found in RNA, it base pairs with adenine and replaces thymine during DNA transcription. CHEBI:15288 CHEBI:27210 CHEBI:46375 CHEBI:9882 chebi_ontology 2,4(1H,3H)-pyrimidinedione 2,4-Dioxopyrimidine 2,4-Pyrimidinedione U URACIL Ura Uracil Urazil uracil CHEBI:17568 uracil 2,4(1H,3H)-pyrimidinedione nist 2,4-Dioxopyrimidine hmdb 2,4-Pyrimidinedione hmdb U chebi URACIL pdb-ccd Ura iubmb Uracil kegg.compound Urazil chebi uracil uniprot_ft The simplest member of the class toluenes consisting of a benzene core which bears a single methyl substituent. CHEBI:15248 CHEBI:27022 CHEBI:44023 CHEBI:9624 DrugBank:DB01900 KEGG:C01455 PDBeChem:MBN Wikipedia:Toluene TOLUENE Toluene chebi_ontology TOLUENE Toluen Toluene Toluol methylbenzene phenylmethane toluene CHEBI:17578 toluene TOLUENE PDBeChem Toluene KEGG_COMPOUND TOLUENE pdb-ccd Toluen NIST_Chemistry_WebBook Toluen nist Toluene kegg.compound Toluol NIST_Chemistry_WebBook Toluol nist methylbenzene PDBeChem methylbenzene pdb-ccd phenylmethane ChemIDplus phenylmethane chemidplus toluene chebi uniprot_ft Any D-aldose having a chain of six carbon atoms in the molecule. CHEBI:12990 CHEBI:21038 D-aldohexoses CHEBI:17608 D-aldohexose D-aldohexoses ChEBI A glucose with D-configuration. CHEBI:12965 CHEBI:20999 D(+)-glucose D-(+)-glucose Traubenzucker dextrose grape sugar CHEBI:17634 D-glucose D(+)-glucose ChemIDplus D-(+)-glucose NIST_Chemistry_WebBook Traubenzucker ChemIDplus dextrose NIST_Chemistry_WebBook grape sugar ChemIDplus Any compound that supports healthy aging, slows the biological aging process, or extends lifespan. Wikipedia:Geroprotector chebi_ontology anti-aging agent anti-aging agents anti-aging drug anti-aging drugs geroprotective agent geroprotective agents geroprotectors CHEBI:176497 geroprotector anti-aging agent ChEBI anti-aging agent chebi anti-aging agents ChEBI anti-aging agents chebi anti-aging drug ChEBI anti-aging drug chebi anti-aging drugs ChEBI anti-aging drugs chebi geroprotective agent ChEBI geroprotective agent chebi geroprotective agents ChEBI geroprotective agents chebi geroprotectors ChEBI geroprotectors chebi CHEBI:15046 CHEBI:26557 CHEBI:8845 KEGG:C03723 Ribonucleoside diphosphate chebi_ontology Ribonucleoside diphosphate ribonucleoside diphosphates CHEBI:17668 ribonucleoside diphosphat ribonucleoside diphosphate Ribonucleoside diphosphate KEGG_COMPOUND Ribonucleoside diphosphate kegg.compound ribonucleoside diphosphates ChEBI ribonucleoside diphosphates chebi Any member of a group of vitamers that belong to the chemical structural class called butenolides that exhibit biological activity against vitamin C deficiency in animals. The vitamers include <small>L</small>-ascorbic acid and its salt, ionized and oxidized forms. CHEBI:21241 chebi_ontology Vitamin C vitamin C vitamer vitamin C vitamers vitamina C vitamine C vitaminum C CHEBI:176783 vitamin C Vitamin C chebi vitamin C vitamer chebi vitamin C vitamers chebi vitamina C chebi vitamine C chebi vitaminum C chebi Any B-vitamin that exhibits biological activity against vitamin B<small>₉</small> deficiency. Vitamin B<small>₉</small> refers to the many forms of folic acid and its derivatives, including tetrahydrofolic acid (the active form), methyltetrahydrofolate (the primary form found in blood), methenyltetrahydrofolate, folinic acid amongst others. They are present in abundance in green leafy vegetables, citrus fruits, and animal products. Lack of vitamin B<small>₉</small> leads to anemia, a condition in which the body cannot produce sufficient number of red blood cells. Symptoms of vitamin B<small>₉</small> deficiency include fatigue, muscle weakness, and pale skin. chebi_ontology folate vitamer folate vitamers vitamin B-9 vitamin B9 vitamin B9 vitamer vitamin B9 vitamers vitamins B9 CHEBI:176842 vitamin B9 folate vitamer chebi folate vitamers chebi vitamin B-9 chebi vitamin B9 chebi vitamin B9 vitamer chebi vitamin B9 vitamers chebi vitamins B9 chebi A triol with a structure of propane substituted at positions 1, 2 and 3 by hydroxy groups. CHEBI:131422 CHEBI:14334 CHEBI:24351 CHEBI:42998 CHEBI:5448 chebi_ontology 1,2,3-Propanetriol 1,2,3-Trihydroxypropane GLYCEROL Glycerin Glyceritol Glycerol Glyzerin Gro Oelsuess Propanetriol Trihydroxypropane glycerine glycerol glycyl alcohol CHEBI:17754 glycerol 1,2,3-Propanetriol kegg.compound 1,2,3-Trihydroxypropane kegg.compound GLYCEROL pdb-ccd Glycerin kegg.compound Glyceritol hmdb Glycerol kegg.compound Glyzerin chebi Gro jcbn Oelsuess chebi Propanetriol hmdb Trihydroxypropane hmdb glycerine chebi glycerol chebi uniprot_ft glycyl alcohol nist A modified amino acid generated by enzymic means from homocysteine and serine. CHEBI:14059 CHEBI:4048 chebi_ontology Cystathionine DL-Cystathionine cystathione CHEBI:17755 cystathionine Cystathionine kegg.compound DL-Cystathionine chemidplus cystathione chebi Ceramides (<em>N</em>-acyl-sphingoid bases) are a major subclass of sphingoid base derivatives with an amide-linked fatty acid. The fatty acids are typically saturated or monounsaturated with chain lengths from 14 to 26 carbon atoms; the presence of a hydroxyl group on carbon 2 is fairly common. Ceramides are generally precursors of more complex sphingolipids. In the illustrated generalised structure, R<small>^1</small> = OH, OX (where X = acyl, glycosyl, phosphate, phosphonate, etc.), or H. Ceramides (N-acyl-sphingoid bases) are a major subclass of sphingoid base derivatives with an amide-linked fatty acid. The fatty acids are typically saturated or monounsaturated with chain lengths from 14 to 26 carbon atoms; the presence of a hydroxyl group on carbon 2 is fairly common. Ceramides are generally precursors of more complex sphingolipids. In the illustrated generalised structure, R(1) = OH, OX (where X = acyl, glycosyl, phosphate, phosphonate, etc.), or H. CHEBI:12487 CHEBI:13954 CHEBI:23074 CHEBI:7242 KEGG:C00195 Wikipedia:Ceramide Ceramide chebi_ontology Cer Ceramide N-acylated sphingoid a ceramide ceramides CHEBI:17761 ceramide Ceramide KEGG_COMPOUND Cer CBN Cer iubmb Ceramide kegg.compound N-acylated sphingoid CBN N-acylated sphingoid iubmb a ceramide UniProt a ceramide uniprot_ft ceramides ChEBI ceramides chebi The primary alcohol that is the simplest aliphatic alcohol, comprising a methyl and an alcohol group. CHEBI:14588 CHEBI:25227 CHEBI:44080 CHEBI:44553 CHEBI:6816 METHANOL Methanol chebi_ontology CH3OH METHANOL MeOH Methanol Methyl alcohol Methylalkohol carbinol methanol spirit of wood wood alcohol wood naphtha wood spirit CHEBI:17790 methanol METHANOL PDBeChem Methanol KEGG_COMPOUND CH3OH chebi METHANOL pdb-ccd MeOH chebi Methanol kegg.compound Methyl alcohol kegg.compound Methylalkohol nist carbinol chemidplus methanol uniprot_ft spirit of wood hmdb wood alcohol chemidplus wood naphtha chemidplus wood spirit nist CHEBI:25968 CHEBI:8074 chebi_ontology a phenolic steroid phenolic steroids CHEBI:177917 phenolic steroid a phenolic steroid uniprot_ft phenolic steroids chebi A compound containing at least one carbon-halogen bond (where X is a halogen atom). CHEBI:13444 CHEBI:36684 CHEBI:8767 chebi_ontology RX organic halide organic halides organohalogen compounds CHEBI:17792 organohalogen compound RX kegg.compound uniprot_ft organic halide kegg.compound organic halides chebi organohalogen compounds chebi An α-amino acid that is alanine substituted at position 3 by a hydroxy group. CHEBI:15081 CHEBI:26648 CHEBI:9116 Serine chebi_ontology 2-Amino-3-hydroxypropionic acid 2-amino-3-hydroxypropanoic acid 3-Hydroxyalanine Serin Serine CHEBI:17822 serine Serine KEGG_COMPOUND 2-Amino-3-hydroxypropionic acid kegg.compound 2-amino-3-hydroxypropanoic acid iupac 3-Hydroxyalanine kegg.compound Serin chebi Serine kegg.compound A single-stranded RNA molecule containing about 70-90 nucleotides, folded by intrastrand base pairing into a characteristic secondary ('cloverleaf') structure that carries a specific amino acid and matches it to its corresponding codon on an mRNA during protein synthesis. CHEBI:10652 CHEBI:15145 CHEBI:15163 CHEBI:15164 CHEBI:15165 KEGG:C00066 RNA, transfer tRNA CHEBI:17843 transfer RNA RNA, transfer ChemIDplus tRNA KEGG_COMPOUND UniProt Any glyceride resulting from the condensation of all three hydroxy groups of glycerol (propane-1,2,3-triol) with fatty acids. CHEBI:15255 CHEBI:27085 CHEBI:9664 chebi_ontology Triacylglycerol Triglycerid Triglyceride Triglyzerid a triacylglycerol triacylglycerols triglycerides CHEBI:17855 triglyceride Triacylglycerol kegg.compound Triglycerid chebi Triglyceride kegg.compound Triglyzerid chebi a triacylglycerol uniprot_ft triacylglycerols lipidmaps triglycerides chebi An α,ω-dicarboxylic acid that is a linear five-carbon dicarboxylic acid. CHEBI:24330 CHEBI:43097 CHEBI:5434 Pentanedioic acid chebi_ontology 1,3-Propanedicarboxylic acid 1,5-pentanedioic acid GLUTARIC ACID Glutaric acid Glutarsaeure Pentanedioic acid CHEBI:17859 glutaric acid Pentanedioic acid KEGG_COMPOUND 1,3-Propanedicarboxylic acid kegg.compound 1,5-pentanedioic acid nist GLUTARIC ACID pdb-ccd Glutaric acid kegg.compound Glutarsaeure chebi Pentanedioic acid kegg.compound A mononuclear parent hydride consisting of covalently bonded hydrogen and chlorine atoms. CHEBI:13364 CHEBI:24635 CHEBI:5590 chebi_ontology Chlorwasserstoff HCl Hydrochloride Hydrogen chloride Hydrogenchlorid Wasserstoffchlorid [HCl] chlorure d'hydrogene cloruro de hidrogeno hydrochloric acid CHEBI:17883 hydrogen chloride Chlorwasserstoff chebi HCl kegg.compound Hydrochloride kegg.compound Hydrogen chloride kegg.compound Hydrogenchlorid chebi Wasserstoffchlorid chebi [HCl] iupac chlorure d'hydrogene chebi cloruro de hidrogeno chebi hydrochloric acid chemidplus A molecular entity that can transfer ("donate") an electron, a pair of electrons, an atom or a group to another molecular entity. CHEBI:14202 CHEBI:4697 KEGG:C01351 Donor chebi_ontology Donator Donor donneur CHEBI:17891 donor Donor KEGG_COMPOUND Donator ChEBI Donator chebi Donor kegg.compound donneur ChEBI donneur chebi A 2-hydroxy monocarboxylic acid having (2<i>R</i>)-configuration. CHEBI:10973 CHEBI:18649 CHEBI:309 chebi_ontology (2R)-2-hydroxy monocarboxylic acids (2R)-Hydroxy-carboxylate (R)-2-Hydroxyacid (R)-2-Hydroxycarboxylic acid CHEBI:17893 (2R)-2-hydroxy monocarboxylic acid (2R)-2-hydroxy monocarboxylic acids chebi (2R)-Hydroxy-carboxylate kegg.compound (R)-2-Hydroxyacid kegg.compound (R)-2-Hydroxycarboxylic acid kegg.compound An optically active form of tyrosine having L-configuration. CHEBI:13181 CHEBI:21411 CHEBI:46070 CHEBI:46161 CHEBI:6313 DrugBank:DB00135 ECMDB:ECMDB00158 HMDB:HMDB0000158 KEGG:C00082 KEGG:D00022 KNApSAcK:C00001397 MetaCyc:TYR PDBeChem:TYR Wikipedia:Tyrosine YMDB:YMDB00364 L-Tyrosine (-)-alpha-amino-p-hydroxyhydrocinnamic acid (2S)-2-amino-3-(4-hydroxyphenyl)propanoic acid (S)-(-)-Tyrosine (S)-2-Amino-3-(p-hydroxyphenyl)propionic acid (S)-3-(p-Hydroxyphenyl)alanine (S)-Tyrosine (S)-alpha-amino-4-hydroxybenzenepropanoic acid 4-hydroxy-L-phenylalanine L-Tyrosin TYROSINE Tyr Tyrosine Y CHEBI:17895 L-tyrosine L-Tyrosine KEGG_COMPOUND (-)-alpha-amino-p-hydroxyhydrocinnamic acid NIST_Chemistry_WebBook (2S)-2-amino-3-(4-hydroxyphenyl)propanoic acid IUPAC (S)-(-)-Tyrosine HMDB (S)-2-Amino-3-(p-hydroxyphenyl)propionic acid KEGG_COMPOUND (S)-3-(p-Hydroxyphenyl)alanine KEGG_COMPOUND (S)-Tyrosine HMDB (S)-alpha-amino-4-hydroxybenzenepropanoic acid NIST_Chemistry_WebBook 4-hydroxy-L-phenylalanine NIST_Chemistry_WebBook L-Tyrosin ChEBI TYROSINE PDBeChem Tyr ChEBI Tyrosine KEGG_COMPOUND Y ChEBI A short-chain fatty acid anion that is the conjugate base of butyric acid, obtained by deprotonation of the carboxy group. CHEBI:13924 CHEBI:22946 KEGG:C00246 MetaCyc:BUTYRIC_ACID butyrate chebi_ontology 1-butanoate 1-butyrate 1-propanecarboxylate CH3-[CH2]2-COO(-) butanate butanoate butanoic acid, ion(1-) butyrate n-butanoate n-butyrate propanecarboxylate propylformate CHEBI:17968 butyrate butyrate IUPAC 1-butanoate ChEBI 1-butanoate chebi 1-butyrate ChEBI 1-butyrate chebi 1-propanecarboxylate ChEBI 1-propanecarboxylate chebi CH3-[CH2]2-COO(-) IUPAC CH3-[CH2]2-COO(-) iupac butanate ChEBI butanate chebi butanoate ChEBI UniProt butanoate chebi uniprot_ft butanoic acid, ion(1-) ChemIDplus butanoic acid, ion(1-) chemidplus butyrate iupac n-butanoate ChEBI n-butanoate chebi n-butyrate ChemIDplus n-butyrate chemidplus propanecarboxylate ChEBI propanecarboxylate chebi propylformate ChEBI propylformate chebi CHEBI:15047 CHEBI:26559 CHEBI:8846 KEGG:C03802 Ribonucleoside triphosphate chebi_ontology Ribonucleoside triphosphate ribonucleoside triphosphates CHEBI:17972 ribonucleoside triphosphate Ribonucleoside triphosphate KEGG_COMPOUND Ribonucleoside triphosphate kegg.compound ribonucleoside triphosphates ChEBI ribonucleoside triphosphates chebi A halide anion formed when chlorine picks up an electron to form an an anion. CHEBI:13291 CHEBI:13970 CHEBI:3616 CHEBI:3731 CHEBI:48804 Chloride chloride chebi_ontology CHLORIDE ION Chloride Chloride ion Chloride(1-) Chlorine anion Cl(-) Cl- chloride CHEBI:17996 chloride Chloride KEGG_COMPOUND chloride UniProt CHLORIDE ION pdb-ccd Chloride kegg.compound Chloride ion kegg.compound Chloride(1-) chemidplus Chlorine anion nist Cl(-) iupac Cl- kegg.compound chloride uniprot_ft 'Lipids' is a loosely defined term for substances of biological origin that are soluble in nonpolar solvents. They consist of saponifiable lipids, such as glycerides (fats and oils) and phospholipids, as well as nonsaponifiable lipids, principally steroids. CHEBI:14517 CHEBI:25054 CHEBI:6486 KEGG:C01356 Lipid chebi_ontology Lipid CHEBI:18059 lipid Lipid KEGG_COMPOUND Lipid kegg.compound Any polysaccharide containing a substantial proportion of aminomonosaccharide residues. CHEBI:14361 CHEBI:24398 CHEBI:5495 KEGG:C02545 Wikipedia:Glycosaminoglycan Glycosaminoglycan chebi_ontology Glycosaminoglycan Glykosaminoglykan glicosaminoglicano glycosaminoglycane glycosaminoglycans CHEBI:18085 glycosaminoglycan Glycosaminoglycan KEGG_COMPOUND Glycosaminoglycan kegg.compound Glykosaminoglykan ChEBI Glykosaminoglykan chebi glicosaminoglicano IUPAC glicosaminoglicano iupac glycosaminoglycane IUPAC glycosaminoglycane iupac glycosaminoglycans ChEBI glycosaminoglycans chebi The phosphate of choline; and the parent compound of the phosphocholine family. CHEBI:12720 CHEBI:13986 CHEBI:23214 CHEBI:3667 CHEBI:44707 chebi_ontology ChoP Choline phosphate N-Trimethyl-2-aminoethylphosphonate O-Phosphocholine O-phosphocholine PHOSPHOCHOLINE Phosphocholine Phosphoryl-choline Phosphorylcholine Trimethyl(2-(phosphonooxy)ethyl)ammonium CHEBI:18132 phosphocholine ChoP chebi Choline phosphate kegg.compound N-Trimethyl-2-aminoethylphosphonate hmdb O-Phosphocholine kegg.compound O-phosphocholine hmdb PHOSPHOCHOLINE pdb-ccd Phosphocholine kegg.compound Phosphoryl-choline hmdb Phosphorylcholine kegg.compound Trimethyl(2-(phosphonooxy)ethyl)ammonium chemidplus Any six-carbon monosaccharide which in its linear form contains either an aldehyde group at position 1 (aldohexose) or a ketone group at position 2 (ketohexose). CHEBI:14399 CHEBI:24590 CHEBI:5709 GlyGen:G70994MS GlyTouCan:G70994MS KEGG:C00738 Hexose chebi_ontology Hexose WURCS=2.0/1,1,0/[axxxxh-1x_1-5_2*NCC/3=O]/1/ hexoses CHEBI:18133 hexose Hexose KEGG_COMPOUND Hexose kegg.compound WURCS=2.0/1,1,0/[axxxxh-1x_1-5_2*NCC/3=O]/1/ GlyTouCan hexoses ChEBI hexoses chebi A tertiary amine that is ammonia in which each hydrogen atom is substituted by an methyl group. CHEBI:15261 CHEBI:27125 CHEBI:27127 CHEBI:9732 N,N-Dimethylmethanamine chebi_ontology (CH3)3N N(CH3)3 N,N,N-trimethylamine N,N-Dimethylmethanamine NMe3 TMA Trimethylamin Trimethylamine tridimethylaminomethane CHEBI:18139 trimethylamine N,N-Dimethylmethanamine KEGG_COMPOUND (CH3)3N kegg.compound N(CH3)3 chebi N,N,N-trimethylamine chebi N,N-Dimethylmethanamine kegg.compound NMe3 chebi TMA nist Trimethylamin chebi Trimethylamine kegg.compound tridimethylaminomethane chebi CHEBI:13368 CHEBI:37140 CHEBI:5599 hydrogen halides chebi_ontology hydrogen halide hydrogen halides CHEBI:18140 hydrogen halide hydrogen halides ChEBI hydrogen halide iupac hydrogen halides chebi A biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically. This term is commonly used only for those containing more than ten monosaccharide residues. CHEBI:14864 CHEBI:26205 CHEBI:8322 KEGG:C00420 Polysaccharide chebi_ontology Glycan Glycane Glykan Glykane Polysaccharide glycans polisacarido polisacaridos CHEBI:18154 polysaccharide Polysaccharide KEGG_COMPOUND Glycan KEGG_COMPOUND Glycan kegg.compound Glycane ChEBI Glycane chebi Glykan ChEBI Glykan chebi Glykane ChEBI Glykane chebi Polysaccharide kegg.compound glycans IUPAC glycans iupac polisacarido ChEBI polisacarido chebi polisacaridos IUPAC polisacaridos iupac An alpha-amino acid that is phenylalanine bearing a hydroxy substituent at position 4 on the phenyl ring. An α-amino acid that is phenylalanine bearing a hydroxy substituent at position 4 on the phenyl ring. CHEBI:15277 CHEBI:27176 CHEBI:9800 KEGG:C01536 KNApSAcK:C00001397 Tyrosine chebi_ontology 2-Amino-3-(p-hydroxyphenyl)propionic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 3-(p-Hydroxyphenyl)alanine Tyr Tyrosin Tyrosine Y tirosina CHEBI:18186 tyrosine Tyrosine KEGG_COMPOUND 2-Amino-3-(p-hydroxyphenyl)propionic acid KEGG_COMPOUND 2-Amino-3-(p-hydroxyphenyl)propionic acid kegg.compound 2-amino-3-(4-hydroxyphenyl)propanoic acid IUPAC 2-amino-3-(4-hydroxyphenyl)propanoic acid iupac 3-(p-Hydroxyphenyl)alanine KEGG_COMPOUND 3-(p-Hydroxyphenyl)alanine kegg.compound Tyr ChEBI Tyr chebi Tyrosin ChEBI Tyrosin chebi Tyrosine kegg.compound Y ChEBI Y chebi tirosina ChEBI tirosina chebi The parent compound of the citrulline class consisting of ornithine having a carbamoyl group at the <em>N</em><small>^5</small>-position. CHEBI:14002 CHEBI:3730 Citrulline chebi_ontology 2-Amino-5-uredovaleric acid Cit Citrullin Citrulline DL-2-amino-5-ureidovaleric acid N(5)-(aminocarbonyl)-DL-ornithine N(5)-(aminocarbonyl)ornithine N(5)-carbamoyl-DL-ornithine citrulina dl-citrulline CHEBI:18211 citrulline Citrulline KEGG_COMPOUND 2-Amino-5-uredovaleric acid kegg.compound Cit iupac Citrullin chebi Citrulline kegg.compound DL-2-amino-5-ureidovaleric acid chemidplus N(5)-(aminocarbonyl)-DL-ornithine nist N(5)-(aminocarbonyl)ornithine chebi N(5)-carbamoyl-DL-ornithine nist citrulina chebi dl-citrulline nist An alpha-amino acid that is glutaric acid bearing a single amino substituent at position 2. An α-amino acid that is glutaric acid bearing a single amino substituent at position 2. CHEBI:24314 CHEBI:5431 KEGG:C00302 KEGG:D04341 KNApSAcK:C00001358 KNApSAcK:C00019577 Wikipedia:Glutamic_acid Glutamic acid chebi_ontology 2-Aminoglutaric acid DL-Glutamic acid DL-Glutaminic acid E Glu Glutamate Glutamic acid Glutaminic acid Glutaminsaeure CHEBI:18237 glutamic acid Glutamic acid KEGG_COMPOUND 2-Aminoglutaric acid KEGG_COMPOUND 2-Aminoglutaric acid kegg.compound DL-Glutamic acid KEGG_DRUG DL-Glutamic acid kegg.drug DL-Glutaminic acid KEGG_COMPOUND DL-Glutaminic acid kegg.compound E ChEBI E chebi Glu ChEBI Glu chebi Glutamate KEGG_COMPOUND Glutamate kegg.compound Glutamic acid kegg.compound Glutaminic acid KEGG_COMPOUND Glutaminic acid kegg.compound Glutaminsaeure ChEBI Glutaminsaeure chebi Catechol in which the hydrogen at position 4 is substituted by a 2-aminoethyl group. CHEBI:11695 CHEBI:11930 CHEBI:14203 CHEBI:1764 CHEBI:23886 CHEBI:43686 DrugBank:DB00988 HMDB:HMDB0000073 KEGG:C03758 KEGG:D07870 KNApSAcK:C00001408 LINCS:LSM-4630 MetaCyc:DOPAMINE Wikipedia:Dopamine 4-(2-Aminoethyl)benzene-1,2-diol Dopamine chebi_ontology 2-(3,4-Dihydroxyphenyl)ethylamine 2-(3,4-dihydroxyphenyl)ethylamine 3,4-Dihydroxyphenethylamine 3-Hydroxytyramine 4-(2-Aminoethyl)-1,2-benzenediol 4-(2-Aminoethyl)benzene-1,2-diol 4-(2-aminoethyl)-1,2-benzenediol 4-(2-aminoethyl)catechol 4-(2-aminoethyl)pyrocatechol Deoxyepinephrine Dopamine Hydroxytyramin CHEBI:18243 dopamine 4-(2-Aminoethyl)benzene-1,2-diol KEGG_COMPOUND Dopamine KEGG_COMPOUND 2-(3,4-Dihydroxyphenyl)ethylamine KEGG_COMPOUND 2-(3,4-Dihydroxyphenyl)ethylamine kegg.compound 2-(3,4-dihydroxyphenyl)ethylamine ChEBI 2-(3,4-dihydroxyphenyl)ethylamine chebi 3,4-Dihydroxyphenethylamine KEGG_COMPOUND 3,4-Dihydroxyphenethylamine kegg.compound 3-Hydroxytyramine ChemIDplus 3-Hydroxytyramine chemidplus 4-(2-Aminoethyl)-1,2-benzenediol KEGG_COMPOUND 4-(2-Aminoethyl)-1,2-benzenediol kegg.compound 4-(2-Aminoethyl)benzene-1,2-diol KEGG_COMPOUND 4-(2-Aminoethyl)benzene-1,2-diol kegg.compound 4-(2-aminoethyl)-1,2-benzenediol ChEBI 4-(2-aminoethyl)-1,2-benzenediol chebi 4-(2-aminoethyl)catechol ChemIDplus 4-(2-aminoethyl)catechol chemidplus 4-(2-aminoethyl)pyrocatechol ChemIDplus 4-(2-aminoethyl)pyrocatechol chemidplus Deoxyepinephrine DrugBank Deoxyepinephrine drugbank Dopamine kegg.compound Hydroxytyramin DrugBank Hydroxytyramin drugbank An iron group element atom that has atomic number 26. CHEBI:13322 CHEBI:24872 CHEBI:5974 DrugBank:DB01592 HMDB:HMDB0015531 KEGG:C00023 WebElements:Fe Iron chebi_ontology 26Fe Eisen Fe Iron fer ferrum hierro iron CHEBI:18248 iron atom Iron KEGG_COMPOUND 26Fe IUPAC 26Fe iupac Eisen ChEBI Eisen chebi Fe IUPAC UniProt Fe iupac uniprot_ft Iron KEGG_COMPOUND Iron kegg.compound fer ChEBI fer chebi ferrum IUPAC ferrum iupac hierro ChEBI hierro chebi iron ChEBI iron chebi Any nucleoside where the sugar component is <small>D</small>-ribose. Any nucleoside where the sugar component is D-ribose. CHEBI:13014 CHEBI:13015 CHEBI:13685 CHEBI:21085 CHEBI:26560 CHEBI:4240 CHEBI:8844 KEGG:C00911 Ribonucleoside chebi_ontology Ribonucleoside a ribonucleoside ribonucleosides CHEBI:18254 ribonucleoside Ribonucleoside KEGG_COMPOUND Ribonucleoside kegg.compound a ribonucleoside UniProt a ribonucleoside uniprot_ft ribonucleosides ChEBI ribonucleosides chebi An α-amino acid that is pentanoic acid bearing two amino substituents at positions 2 and 5. CHEBI:7784 2,5-Diaminopentanoic acid Ornithine chebi_ontology 2,5-Diaminopentanoic acid 2,5-Diaminovaleric acid DL-Ornithine Orn Ornithine CHEBI:18257 ornithine 2,5-Diaminopentanoic acid KEGG_COMPOUND Ornithine KEGG_COMPOUND 2,5-Diaminopentanoic acid kegg.compound 2,5-Diaminovaleric acid kegg.compound DL-Ornithine chemidplus Orn iupac Ornithine kegg.compound An iodothyronine compound having iodo substituents at the 3-, 3'- and 5-positions. Although some is produced in the thyroid, most of the 3,3',5-triiodo-<small>L</small>-thyronine in the body is generated by mono-deiodination of <small>L</small>-thyroxine in the peripheral tissues. Its metabolic activity is about 3 to 5 times that of <small>L</small>-thyroxine. The sodium salt is used in the treatment of hypothyroidism. CHEBI:11701 CHEBI:11702 CHEBI:13059 CHEBI:19894 CHEBI:45840 CHEBI:9722 chebi_ontology 3,5,3'-Triiodo-L-thyronine 3,5,3'-Triiodothyronine 3,5,3'TRIIODOTHYRONINE 4-(4-hydroxy-3-iodophenoxy)-3,5-diiodo-L-phenylalanine L-3,3',5-triiodothyronine L-3,5,3'-Triiodothyronine L-T3 L-triiodothyronine Liothyronine O-(4-hydroxy-3-iodophenyl)-3,5-diiodo-L-tyrosine T3 Triiodothyronine CHEBI:18258 3,3',5-triiodo-L-thyronine 3,5,3'-Triiodo-L-thyronine kegg.compound 3,5,3'-Triiodothyronine kegg.compound 3,5,3'TRIIODOTHYRONINE pdb-ccd 4-(4-hydroxy-3-iodophenoxy)-3,5-diiodo-L-phenylalanine iupac L-3,3',5-triiodothyronine hmdb L-3,5,3'-Triiodothyronine kegg.compound L-T3 chemidplus L-triiodothyronine hmdb Liothyronine kegg.compound O-(4-hydroxy-3-iodophenyl)-3,5-diiodo-L-tyrosine iupac T3 chebi kegg.compound Triiodothyronine kegg.compound That part of DNA or RNA that may be involved in pairing. CHEBI:13873 CHEBI:25598 CHEBI:2995 KEGG:C00701 Wikipedia:Nucleobase Base chebi_ontology Base nucleobases CHEBI:18282 nucleobase Base KEGG_COMPOUND Base KEGG_COMPOUND Base kegg.compound nucleobases ChEBI nucleobases chebi A member of the class of imidazoles that is 1<em>H</em>-imidazole substituted at position C-4 by a 2-aminoethyl group. A member of the class of imidazoles that is 1H-imidazole substituted at position C-4 by a 2-aminoethyl group. CHEBI:14401 CHEBI:24596 CHEBI:43187 CHEBI:817 HMDB:HMDB0000870 KEGG:C00388 KEGG:D08040 KNApSAcK:C00001414 MetaCyc:HISTAMINE PDBeChem:HSM Wikipedia:Histamine HISTAMINE Histamine chebi_ontology 1H-Imidazole-4-ethanamine 2-(4-Imidazolyl)ethylamine HISTAMINE Histamine CHEBI:18295 histamine HISTAMINE PDBeChem Histamine KEGG_COMPOUND 1H-Imidazole-4-ethanamine KEGG_COMPOUND 1H-Imidazole-4-ethanamine kegg.compound 2-(4-Imidazolyl)ethylamine KEGG_COMPOUND 2-(4-Imidazolyl)ethylamine kegg.compound HISTAMINE pdb-ccd Histamine kegg.compound An acyclic branched or unbranched hydrocarbon having the general formula C<small>_<em>n</em></small>H<small>_{2<em>n</em>+2}</small>, and therefore consisting entirely of hydrogen atoms and saturated carbon atoms. CHEBI:13435 CHEBI:22317 CHEBI:2576 Alkane chebi_ontology Alkan Alkane RH alcane alcanes alcano alcanos an alkane CHEBI:18310 alkane Alkane KEGG_COMPOUND Alkan chebi Alkane kegg.compound RH kegg.compound alcane iupac alcanes iupac alcano iupac alcanos iupac an alkane uniprot_ft The R-enantiomer of noradrenaline. CHEBI:1 CHEBI:14668 CHEBI:25592 CHEBI:258884 CHEBI:43725 DrugBank:DB00368 HMDB:HMDB0000216 KEGG:C00547 KEGG:D00076 KNApSAcK:C00001424 PDBeChem:LNR Wikipedia:Norepinephrine (-)-arterenol (-)-noradrenaline (-)-norepinephrine (R)-(-)-norepinephrine (R)-4-(2-amino-1-hydroxyethyl)-1,2-benzenediol (R)-norepinephrine 4-[(1R)-2-Amino-1-hydroxyethyl]-1,2-benzenediol Arterenol L-NOREPINEPHRINE L-Noradrenaline Noradrenaline Norepinephrine CHEBI:18357 (R)-noradrenaline (-)-arterenol ChemIDplus (-)-noradrenaline IUPHAR (-)-norepinephrine ChemIDplus (R)-(-)-norepinephrine ChemIDplus (R)-4-(2-amino-1-hydroxyethyl)-1,2-benzenediol ChemIDplus (R)-norepinephrine ChemIDplus 4-[(1R)-2-Amino-1-hydroxyethyl]-1,2-benzenediol KEGG_COMPOUND Arterenol KEGG_COMPOUND L-NOREPINEPHRINE PDBeChem L-Noradrenaline KEGG_COMPOUND Noradrenaline KEGG_COMPOUND Norepinephrine KEGG_COMPOUND A phosphate ion that is the conjugate base of hydrogenphosphate. CHEBI:14791 CHEBI:45024 CHEBI:7793 KEGG:C00009 PDBeChem:PO4 Wikipedia:Phosphate Phosphate chebi_ontology Orthophosphate PHOSPHATE ION PO4(3-) Phosphate [PO4](3-) CHEBI:18367 phosphate(3-) Phosphate KEGG_COMPOUND Orthophosphate KEGG_COMPOUND Orthophosphate kegg.compound PHOSPHATE ION PDBeChem PHOSPHATE ION pdb-ccd PO4(3-) IUPAC PO4(3-) iupac Phosphate KEGG_COMPOUND Phosphate kegg.compound [PO4](3-) IUPAC [PO4](3-) iupac Any polyunsaturated fatty acid carrying one or more hydroperoxy substituents. chebi_ontology hydroperoxy polyunsaturated fatty acids CHEBI:189832 hydroperoxy polyunsaturated fatty acid hydroperoxy polyunsaturated fatty acids chebi Any fatty acid containing two carboxy groups. chebi_ontology CHEBI:189840 dicarboxylic fatty acid Any fatty acid that contains 2 carboxylic groups. Major microspecies at pH 7.3 chebi_ontology CHEBI:189846 dicarboxylic fatty acid dianion A calcium salt that lacks C-H bonds CHEBI:190295 inorganic calcium salt Any unsaturated fatty acid carrying one or more hydroperoxy substituents. chebi_ontology hydroperoxy unsaturated fatty acids CHEBI:194321 hydroperoxy unsaturated fatty acid hydroperoxy unsaturated fatty acids chebi The trialkylammonium ion resulting from the protonation of the amino group of oripavine; Major species at pH 7.3. chebi_ontology 3-O-demethylthebaine cation 3-O-demethylthebaine(1+) oripavine oripavine cation CHEBI:194499 oripavine(1+) 3-O-demethylthebaine cation chebi 3-O-demethylthebaine(1+) chebi oripavine uniprot_ft oripavine cation chebi A catecholamine in which the aminoethyl side-chain is hydroxy-substituted at C-1 and methylated on nitrogen. chebi_ontology CHEBI:194548 4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol An <em>N</em>-acyl-<small>D</small>-α-amino acid anion resulting from deprotonation of both carboxy groups of <em>N</em>-acetyl-<small>D</small>-aspartic acid. Major microspecies at pH 7.3. chebi_ontology N-acetyl-D-Asp N-acetyl-D-aspartate CHEBI:195274 N-acetyl-D-aspartate(2-) N-acetyl-D-Asp submitter N-acetyl-D-aspartate uniprot_ft CHEBI:20664 5beta-cholane Any compound having 6-aminopurine (adenine) as part of its structure. 6-aminopurines chebi_ontology 6-aminopurines CHEBI:20706 6-aminopurines 6-aminopurines ChEBI 6-aminopurines chebi An <em>N</em>-acetyl-amino acid having <small>D</small>-configuration. CHEBI:7109 chebi_ontology N-Acetyl-D-amino-acid N-acetyl-D-amino acids CHEBI:21501 N-acetyl-D-amino acid N-Acetyl-D-amino-acid kegg.compound N-acetyl-D-amino acids chebi An <small>L</small>-amino acid having an <em>N</em>-acetyl substituent. chebi_ontology CHEBI:21545 N-acetyl-L-amino acid An <em>N</em>-acyl-<small>L</small>-aspartic acid in which the acyl group is specified as acetyl. chebi_ontology (S)-2-(acetylamino)butanedioic acid (S)-2-(acetylamino)succinic acid L-N-acetylaspartic acid N-acetylaspartic acid NAA acetyl-L-aspartic acid acetylaspartic acid CHEBI:21547 N-acetyl-L-aspartic acid (S)-2-(acetylamino)butanedioic acid chebi (S)-2-(acetylamino)succinic acid hmdb L-N-acetylaspartic acid hmdb N-acetylaspartic acid chemidplus NAA hmdb acetyl-L-aspartic acid hmdb acetylaspartic acid chemidplus An <em>N</em>-acyl-amino acid that has acetyl as the acyl group. CHEBI:7105 chebi_ontology N-Acetyl amino acid N-acetyl-amino acids CHEBI:21575 N-acetyl-amino acid N-Acetyl amino acid kegg.compound N-acetyl-amino acids chebi Any <em>N</em>-acylamino acid having <small>L</small>-configuration. chebi_ontology CHEBI:21644 N-acyl-L-amino acid <small>L</small>-Aspartic acid substituted at nitrogen by an acyl group. chebi_ontology N-acyl-L-aspartic acids CHEBI:21647 N-acyl-L-aspartic acid N-acyl-L-aspartic acids chebi An aspartic acid derivative that is aspartic acid in which one of the hydrogens attached to the amino group is replaced by an acyl group. chebi_ontology CHEBI:21654 N-acyl-aspartic acid A glycosyl compound arising formally from the elimination of water from a glycosidic hydroxy group and an H atom bound to a nitrogen atom, thus creating a C-N bond. chebi_ontology N-glycoside N-glycosides N-glycosyl compounds glycosylamines CHEBI:21731 N-glycosyl compound N-glycoside ChEBI N-glycoside chebi N-glycosides ChEBI N-glycosides chebi N-glycosyl compounds ChEBI N-glycosyl compounds chebi glycosylamines IUPAC glycosylamines iupac O-phosphoamino acids CHEBI:21968 O-phosphoamino acid O-phosphoamino acids ChEBI Compounds with the general formula RNHC(=O)CH3. Compounds with the general formula RNHC(=O)CH<small>₃</small>. chebi_ontology CHEBI:22160 acetamides Any amino acid derivative that is the <em>N</em>-acetyl or <em>O</em>-acetyl derivative of an amino acid. chebi_ontology acetyl-amino acids CHEBI:22195 acetyl-amino acid acetyl-amino acids chebi An organic group formed by removing one or more hydroxy groups from an oxoacid that has the general structure R<small>_<em>k</em></small>E(=O)<small>_<em>l</em></small>(OH)<small>_<em>m</em></small> (<em>l</em> ≠ 0). Although the term is almost always applied to organic compounds, with carboxylic acid as the oxoacid, acyl groups can in principle be derived from other types of acids such as sulfonic acids or phosphonic acids. An organic group formed by removing one or more hydroxy groups from an oxoacid that has the general structure RkE(=O)l(OH)m (l =/= 0). Although the term is almost always applied to organic compounds, with carboxylic acid as the oxoacid, acyl groups can in principle be derived from other types of acids such as sulfonic acids or phosphonic acids. acyl group chebi_ontology acyl group acyl groups alkanoyl group groupe acyle CHEBI:22221 acyl group acyl group IUPAC acyl group iupac acyl groups ChEBI acyl groups chebi alkanoyl group ChEBI alkanoyl group chebi groupe acyle IUPAC groupe acyle iupac chebi_ontology adenosine phosphates CHEBI:22256 adenosine phosphate adenosine phosphates ChEBI adenosine phosphates chebi Any purine ribonucleoside that is a derivative of adenosine. chebi_ontology CHEBI:22260 adenosines chebi_ontology Erdalkalimetall Erdalkalimetalle alkaline earth metal alkaline-earth metal alkaline-earth metals metal alcalino-terreux metal alcalinoterreo metales alcalinoterreos metaux alcalino-terreux CHEBI:22313 alkaline earth metal atom Erdalkalimetall ChEBI Erdalkalimetall chebi Erdalkalimetalle ChEBI Erdalkalimetalle chebi alkaline earth metal ChEBI alkaline earth metal chebi alkaline-earth metal ChEBI alkaline-earth metal chebi alkaline-earth metals ChEBI alkaline-earth metals chebi metal alcalino-terreux ChEBI metal alcalino-terreux chebi metal alcalinoterreo ChEBI metal alcalinoterreo chebi metales alcalinoterreos ChEBI metales alcalinoterreos chebi metaux alcalino-terreux ChEBI metaux alcalino-terreux chebi chebi_ontology Alkalimetall Alkalimetalle alkali metal metal alcalin metal alcalino metales alcalinos metaux alcalins CHEBI:22314 alkali metal atom Alkalimetall ChEBI Alkalimetall chebi Alkalimetalle ChEBI Alkalimetalle chebi alkali metal ChEBI alkali metal chebi metal alcalin ChEBI metal alcalin chebi metal alcalino ChEBI metal alcalino chebi metales alcalinos ChEBI metales alcalinos chebi metaux alcalins ChEBI metaux alcalins chebi Any of the naturally occurring, basic nitrogen compounds (mostly heterocyclic) occurring mostly in the plant kingdom, but also found in bacteria, fungi, and animals. By extension, certain neutral compounds biogenetically related to basic alkaloids are also classed as alkaloids. Amino acids, peptides, proteins, nucleotides, nucleic acids, amino sugars and antibiotics are not normally regarded as alkaloids. Compounds in which the nitrogen is exocyclic (dopamine, mescaline, serotonin, etc.) are usually classed as amines rather than alkaloids. Wikipedia:Alkaloid Alkaloid chebi_ontology Alkaloid Alkaloide alcaloide alcaloides CHEBI:22315 alkaloid Alkaloid ChEBI Alkaloid chebi Alkaloide ChEBI Alkaloide chebi alcaloide ChEBI alcaloide chebi alcaloides ChEBI alcaloides chebi A univalent group ‒C<small>_<em>n</em></small>H<small>_{2<em>n</em>+1}</small> derived from an alkane by removal of a hydrogen atom from any carbon atom. chebi_ontology groupe alkyle grupo alquilo grupos alquilo CHEBI:22323 alkyl group groupe alkyle iupac grupo alquilo iupac grupos alquilo iupac Any amine formally derived from ammonia by replacing one, two or three hydrogen atoms by alkyl groups. chebi_ontology CHEBI:22331 alkylamines Highly reactive chemical that introduces alkyl radicals into biologically active molecules and thereby prevents their proper functioning. It could be used as an antineoplastic agent, but it might be very toxic, with carcinogenic, mutagenic, teratogenic, and immunosuppressant actions. It could also be used as a component of poison gases. chebi_ontology CHEBI:22333 alkylating agent An alcohol containing an amino functional group in addition to the alcohol-defining hydroxy group. chebi_ontology amino alcohols aminoalcohol aminoalcohols CHEBI:22478 amino alcohol amino alcohols chebi aminoalcohol chebi aminoalcohols chebi Any aldehyde which contains an amino group. CHEBI:22492 amino aldehyde chebi_ontology aminobenzoates CHEBI:22494 aminobenzoate aminobenzoates chebi chebi_ontology Aminobenzoesaeure CHEBI:22495 aminobenzoic acid Aminobenzoesaeure chebi An amino alcohol having two hydroxy functional groups. chebi_ontology amino diol amino diols aminodiols CHEBI:22501 aminodiol amino diol chebi amino diols chebi aminodiols chebi chebi_ontology aminoglycans CHEBI:22506 aminoglycan aminoglycans ChEBI aminoglycans chebi Any purine having at least one amino substituent. chebi_ontology aminopurines CHEBI:22527 aminopurine aminopurines ChEBI aminopurines chebi A monoatomic or polyatomic species having one or more elementary charges of the electron. Anion chebi_ontology Anion Anionen anion aniones anions CHEBI:22563 anion Anion ChEBI Anion chebi Anionen ChEBI Anionen chebi anion chebi aniones ChEBI aniones chebi anions IUPAC anions iupac A substance that opposes oxidation or inhibits reactions brought about by dioxygen or peroxides. chebi_ontology antioxidants antioxydant antoxidant CHEBI:22586 antioxidant antioxidants ChEBI antioxidants chebi antioxydant ChEBI antioxydant chebi antoxidant ChEBI antoxidant chebi A ketoaldonate that is the conjugate base of ascorbic acid. chebi_ontology CHEBI:22651 ascorbate chebi_ontology CHEBI:22652 ascorbic acid An <small>L</small>-α-amino acid which is <small>L</small>-aspartic acid or any of the essential amino acids biosynthesised from it (asparagine, lysine, methionine, threonine and isoleucine). A closed class. chebi_ontology aspartate family amino acids aspartic acid family amino acid aspartic acid family amino acids oxaloacetate family amino acid oxaloacetate family amino acids oxaloacetate/aspartate family amino acid oxaloacetate/aspartate family amino acids CHEBI:22658 aspartate family amino acid aspartate family amino acids chebi aspartic acid family amino acid chebi aspartic acid family amino acids chebi oxaloacetate family amino acid chebi oxaloacetate family amino acids chebi oxaloacetate/aspartate family amino acid chebi oxaloacetate/aspartate family amino acids chebi An α-amino acid that consists of succinic acid bearing a single α-amino substituent chebi_ontology (+-)-Aspartic acid (R,S)-Aspartic acid 2-aminobutanedioic acid Asp Aspartic acid D DL-Aminosuccinic acid DL-Asparagic acid CHEBI:22660 aspartic acid (+-)-Aspartic acid chemidplus (R,S)-Aspartic acid chemidplus 2-aminobutanedioic acid iupac Asp chebi Aspartic acid kegg.compound D chebi DL-Aminosuccinic acid chemidplus DL-Asparagic acid chemidplus An amino acid derivative resulting from reaction of aspartic acid at the amino group or either of the carboxy groups, or from the replacement of any hydrogen of aspartic acid by a heteroatom. The definition normally excludes peptides containing aspartic acid residues. chebi_ontology CHEBI:22661 aspartic acid derivative A molecular entity having an available pair of electrons capable of forming a covalent bond with a hydron (Bronsted base) or with the vacant orbital of some other molecular entity (Lewis base). A molecular entity having an available pair of electrons capable of forming a covalent bond with a hydron (Brønsted base) or with the vacant orbital of some other molecular entity (Lewis base). KEGG:C00701 Base chebi_ontology Base Base1 Base2 Basen Nucleobase base bases CHEBI:22695 base Base ChEBI Base chebi Base1 KEGG_COMPOUND Base1 kegg.compound Base2 KEGG_COMPOUND Base2 kegg.compound Basen ChEBI Basen chebi Nucleobase KEGG_COMPOUND Nucleobase kegg.compound base chebi bases ChEBI bases chebi Any benzenoid aromatic compound consisting of the benzene skeleton and its substituted derivatives. chebi_ontology CHEBI:22712 benzenes A monocarboxylic acid anion obtained by deprotonation of the carboxy group of any benzoic acid. chebi_ontology benzoate anion CHEBI:22718 benzoates benzoate anion chebi Any aromatic carboxylic acid that consists of benzene in which at least a single hydrogen has been substituted by a carboxy group. chebi_ontology CHEBI:22723 benzoic acids chebi_ontology benzopyrans CHEBI:22727 benzopyran benzopyrans chebi chebi_ontology benzopyrroles CHEBI:22728 benzopyrrole benzopyrroles ChEBI benzopyrroles chebi chebi_ontology Bn C6H5-CH2- phenylalanine side-chain phenylmethyl CHEBI:22744 benzyl group Bn ChEBI Bn chebi C6H5-CH2- IUPAC C6H5-CH2- iupac phenylalanine side-chain ChEBI phenylalanine side-chain chebi phenylmethyl IUPAC phenylmethyl iupac Any compound that produces a peak used as reference frequency in the delta chemical shift scale. Any compound that produces a peak used as reference frequency in the δ chemical shift scale. chebi_ontology NMR chemical shift reference compounds NMR chemical shift standard NMR chemical shift standards NMR internal standard NMR internal standards NMR reference standard NMR reference standards CHEBI:228364 NMR chemical shift reference compound NMR chemical shift reference compounds ChEBI NMR chemical shift reference compounds chebi NMR chemical shift standard ChEBI NMR chemical shift standard chebi NMR chemical shift standards ChEBI NMR chemical shift standards chebi NMR internal standard ChEBI NMR internal standard chebi NMR internal standards ChEBI NMR internal standards chebi NMR reference standard ChEBI NMR reference standard chebi NMR reference standards ChEBI NMR reference standards chebi Any amino acid-derived zwitterion - such as glycine betaine (<em>N</em>,<em>N</em>,<em>N</em>-trimethylammonioacetate) - in which the ammonium nitrogen carries methyl substituents and bears no hydrogen atoms. chebi_ontology amino acid betaines amino-acid betaines betaines CHEBI:22860 amino-acid betaine amino acid betaines chebi amino-acid betaines chebi betaines chebi A sodium salt of the conjugate of any bile acid with either glycine or taurine. KEGG:C01558 chebi_ontology Bile acid bile salts CHEBI:22868 bile salt Bile acid KEGG_COMPOUND Bile acid kegg.compound bile salts ChEBI bile salts chebi chebi_ontology CHEBI:22881 biopterins Any amino acid in which the parent hydrocarbon chain has one or more alkyl substituents chebi_ontology branched chain amino acids CHEBI:22918 branched-chain amino acid branched chain amino acids chebi The conjugate base of a fatty amide, arising from deprotonation of the carboxylic acid group of the corresponding fatty amide. chebi_ontology fatty amide anions CHEBI:229684 fatty amide anion fatty amide anions chebi DrugBank:DB01373 KEGG:C00076 WebElements:Ca chebi_ontology 20Ca Ca Calcium Kalzium calcio calcium CHEBI:22984 calcium atom 20Ca IUPAC 20Ca iupac Ca IUPAC UniProt Ca iupac uniprot_ft Calcium KEGG_COMPOUND Calcium kegg.compound Kalzium ChEBI Kalzium chebi calcio ChEBI calcio chebi calcium ChEBI calcium chebi calcium molecular entity calcium compounds calcium molecular entities CHEBI:22985 calcium molecular entity calcium molecular entity ChEBI calcium compounds ChEBI calcium molecular entities ChEBI The univalent carboacyl group formed by loss of -OH from the carboxy group of carbamic acid. chebi_ontology -C(O)NH2 -CONH2 aminocarbonyl carbamyl carbamyl group carboxamide CHEBI:23004 carbamoyl group -C(O)NH2 ChEBI -C(O)NH2 chebi -CONH2 IUPAC -CONH2 iupac aminocarbonyl IUPAC aminocarbonyl iupac carbamyl ChEBI carbamyl chebi carbamyl group ChEBI carbamyl group chebi carboxamide IUPAC carboxamide iupac chebi_ontology carbon oxides oxides of carbon CHEBI:23014 carbon oxide carbon oxides ChEBI carbon oxides chebi oxides of carbon ChEBI oxides of carbon chebi Organooxygen compounds that are salts or esters of carbonic acid, H2CO3. CHEBI:23016 carbonates carbonyl group chebi_ontology >C=O carbonyl group CHEBI:23019 carbonyl group carbonyl group ChEBI UniProt >C=O IUPAC >C=O iupac carbonyl group chebi uniprot_ft Any member of a group of glycosphingolipids, also known as monoglycosylceramides, which are important components in animal muscle and nerve cell membranes. cerebrosides monoglycosylceramide monoglycosylceramides CHEBI:23079 cerebroside cerebrosides ChEBI monoglycosylceramide ChEBI monoglycosylceramides ChEBI chebi_ontology 17Cl Chlor Cl chlore chlorine chlorum cloro CHEBI:23116 chlorine atom 17Cl iupac Chlor chebi Cl iupac chlore chebi chlorine chebi chlorum chebi cloro chebi A halogen molecular entity containing one or more atoms of chlorine. chebi_ontology CHEBI:23117 chlorine molecular entity CHEBI:3666 chebi_ontology choline esters CHEBI:23213 choline ester choline esters ChEBI choline esters chebi A quaternary ammonium ion based on the choline ion and its substituted derivatives thereof. chebi_ontology CHEBI:23217 cholines Any member of the class of chromanes that is chromane substituted by one or more hydroxy groups. chebi_ontology CHEBI:23229 chromanol chebi_ontology CHEBI:23230 chromanes A chelator that is any compound containing a ligand (typically organic) which is able to form a bond to a central calcium atom at two or more points. chebi_ontology calcium chelating agent calcium chelating agents calcium chelators CHEBI:232436 calcium chelator calcium chelating agent chebi calcium chelating agents chebi calcium chelators chebi chebi_ontology citrullines CHEBI:23324 citrullines citrullines chebi chebi_ontology an N-acetyl-L-alpha-amino acid CHEBI:233443 N-acetyl-L-alpha-amino acid anion an N-acetyl-L-alpha-amino acid uniprot_ft A low-molecular-weight, non-protein organic compound participating in enzymatic reactions as dissociable acceptor or donor of chemical groups or electrons. chebi_ontology coenzymes CHEBI:23354 coenzyme coenzymes chebi An organic molecule or ion (usually a metal ion) that is required by an enzyme for its activity. It may be attached either loosely (coenzyme) or tightly (prosthetic group). Wikipedia:Cofactor_(biochemistry) cofactor chebi_ontology cofactor CHEBI:23357 cofactor cofactor IUPAC cofactor iupac Any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer etc., identifiable as a separately distinguishable entity. chebi_ontology entidad molecular entidades moleculares entite moleculaire molecular entities molekulare Entitaet CHEBI:23367 molecular entity entidad molecular IUPAC entidad molecular iupac entidades moleculares IUPAC entidades moleculares iupac entite moleculaire IUPAC entite moleculaire iupac molecular entities IUPAC molecular entities iupac molekulare Entitaet ChEBI molekulare Entitaet chebi chebi_ontology copper compounds copper molecular entities copper molecular entity CHEBI:23377 copper molecular entity copper compounds chebi copper molecular entities chebi copper molecular entity chebi CHEBI:3990 chebi_ontology cyclic amide cyclic amides CHEBI:23443 cyclic amide cyclic amide chebi cyclic amides chebi chebi_ontology Cyclopeptid Zyklopeptid cyclic peptides peptide cyclique peptido ciclico CHEBI:23449 cyclic peptide Cyclopeptid ChEBI Cyclopeptid chebi Zyklopeptid ChEBI Zyklopeptid chebi cyclic peptides ChEBI cyclic peptides chebi peptide cyclique IUPAC peptide cyclique iupac peptido ciclico IUPAC peptido ciclico iupac chebi_ontology cystathionines CHEBI:23505 cystathionines cystathionines chebi An amino acid derivative resulting from reaction of cysteine at the amino group, carboxy group, or thiol group, or from the replacement of any hydrogen of cysteine by a heteroatom. The definition normally excludes peptides containing cysteine residues. CHEBI:25309 chebi_ontology cysteine derivative cysteine derivatives CHEBI:23509 cysteine derivative cysteine derivative chebi cysteine derivatives chebi An azole that is either one of a pair of heterocyclic organic compounds comprising three carbon atoms and two nitrogen atoms arranged in a ring. chebi_ontology diazoles CHEBI:23677 diazole diazoles ChEBI diazoles chebi chebi_ontology CHEBI:237958 ({[(2R,3S,4R,5R)-3,4-dihydroxy-5-(9H-purin-9-yl)oxolan-2-yl]methyl phosphonato}oxy)(phosphonatooxy)phosphinate A compound that contains two hydroxy groups, generally assumed to be, but not necessarily, alcoholic. Aliphatic diols are also called glycols. chebi_ontology CHEBI:23824 diol Any terpenoid derived from a diterpene. The term includes compounds in which the C20 skeleton of the parent diterpene has been rearranged or modified by the removal of one or more skeletal atoms (generally methyl groups). chebi_ontology C20 isoprenoids diterpenoides CHEBI:23849 diterpenoid C20 isoprenoids lipidmaps diterpenoides chebi Any substance which when absorbed into a living organism may modify one or more of its functions. The term is generally accepted for a substance taken for a therapeutic purpose, but is also commonly used for abused substances. chebi_ontology drugs medicine CHEBI:23888 drug drugs ChEBI drugs chebi medicine ChEBI medicine chebi Any member of the group of signalling molecules arising from oxidation of the three C<small>₂₀</small> essential fatty acids (EFAs) icosapentaenoic acid (EPA), arachidonic acid (AA) and dihomo-gamma-linolenic acid (DGLA). chebi_ontology eicosanoid eicosanoids icosanoid icosanoids CHEBI:23899 icosanoid eicosanoid chebi eicosanoids chebi icosanoid lipidmaps icosanoids chebi chebi_ontology monoatomic anions CHEBI:23905 monoatomic anion monoatomic anions chebi chebi_ontology monoatomic cations CHEBI:23906 monoatomic cation monoatomic cations ChEBI monoatomic cations chebi A compound or agent that combines with an enzyme in such a manner as to prevent the normal substrate-enzyme combination and the catalytic reaction. chebi_ontology enzyme inhibitors inhibidor enzimatico inhibidores enzimaticos inhibiteur enzymatique inhibiteurs enzymatiques CHEBI:23924 enzyme inhibitor enzyme inhibitors ChEBI enzyme inhibitors chebi inhibidor enzimatico ChEBI inhibidor enzimatico chebi inhibidores enzimaticos ChEBI inhibidores enzimaticos chebi inhibiteur enzymatique ChEBI inhibiteur enzymatique chebi inhibiteurs enzymatiques ChEBI inhibiteurs enzymatiques chebi A 3-hydroxy steroid that is estra-1,3,5(10)-triene substituted by hydroxy groups at positions 3 and 17. CHEBI:42364 chebi_ontology oestradiol CHEBI:23965 estradiol oestradiol chebi chebi_ontology Oestran oestrane CHEBI:23966 estrane Oestran chebi oestrane jcbn chebi_ontology ethanolamine CHEBI:23981 ethanolamines ethanolamine chebi Any vitamin that dissolves in fats and are stored in body tissues. Unlike the water-soluble vitamins, they are stored in the body for long periods of time and generally pose a greater risk for toxicity when consumed in excess. chebi_ontology fat-soluble vitamin fat-soluble vitamins fettloesliche Vitamine CHEBI:24020 fat-soluble vitamin (role) fat-soluble vitamin chebi fat-soluble vitamins chebi fettloesliche Vitamine chebi chebi_ontology fructosamine fructosamines CHEBI:24103 fructosamine fructosamine chebi fructosamines chebi Compounds containing at least one furan ring. chebi_ontology oxacyclopenta-2,4-dienes CHEBI:24129 furans oxacyclopenta-2,4-dienes chebi Glucocorticoids are a class of steroid hormones that regulate a variety of physiological processes, in particular control of the concentration of glucose in blood. chebi_ontology glucocorticoids CHEBI:24261 glucocorticoid glucocorticoids ChEBI glucocorticoids chebi An amino acid derivative resulting from reaction of glutamic acid at the amino group or either of the carboxy groups, or from the replacement of any hydrogen by a heteroatom. The definition normally excludes peptides containing glutamic acid residues. chebi_ontology CHEBI:24315 glutamic acid derivative An <small>L</small>-α-amino acid which is <small>L</small>-glutamic acid or any of the essential amino acids biosynthesised from it (glutamine, proline and arginine). A closed class. An L-alpha-amino acid which is L-glutamic acid or any of the essential amino acids biosynthesised from it (glutamine, proline and arginine). A closed class. chebi_ontology glutamine family amino acids CHEBI:24318 glutamine family amino acid glutamine family amino acids ChEBI glutamine family amino acids chebi An EC 6.3.* (<em>C</em>‒<em>N</em> bond-forming ligase) inhibitor that interferes with the action of glutamate—ammonia ligase (EC 6.3.1.2). An EC 6.3.* (C-N bond-forming ligase) inhibitor that interferes with the action of glutamate--ammonia ligase (EC 6.3.1.2). Wikipedia:Glutamine_synthetase chebi_ontology EC 6.3.1.2 (glutamate--ammonia ligase) inhibitors EC 6.3.1.2 inhibitor EC 6.3.1.2 inhibitors L-glutamate:ammonia ligase (ADP-forming) inhibitor L-glutamate:ammonia ligase (ADP-forming) inhibitors L-glutamine synthetase inhibitor L-glutamine synthetase inhibitors glutamate--ammonia ligase (EC 6.3.1.2) inhibitor glutamate--ammonia ligase (EC 6.3.1.2) inhibitors glutamate--ammonia ligase inhibitor glutamate--ammonia ligase inhibitors glutamine synthetase inhibitor glutamine synthetase inhibitors glutamylhydroxamic synthetase inhibitor glutamylhydroxamic synthetase inhibitors CHEBI:24319 EC 6.3.1.2 (glutamate--ammonia ligase) inhibitor EC 6.3.1.2 (glutamate--ammonia ligase) inhibitors ChEBI EC 6.3.1.2 (glutamate--ammonia ligase) inhibitors chebi EC 6.3.1.2 inhibitor ChEBI EC 6.3.1.2 inhibitor chebi EC 6.3.1.2 inhibitors ChEBI EC 6.3.1.2 inhibitors chebi L-glutamate:ammonia ligase (ADP-forming) inhibitor ChEBI L-glutamate:ammonia ligase (ADP-forming) inhibitor chebi L-glutamate:ammonia ligase (ADP-forming) inhibitors ChEBI L-glutamate:ammonia ligase (ADP-forming) inhibitors chebi L-glutamine synthetase inhibitor ChEBI L-glutamine synthetase inhibitor chebi L-glutamine synthetase inhibitors ChEBI L-glutamine synthetase inhibitors chebi glutamate--ammonia ligase (EC 6.3.1.2) inhibitor ChEBI glutamate--ammonia ligase (EC 6.3.1.2) inhibitor chebi glutamate--ammonia ligase (EC 6.3.1.2) inhibitors ChEBI glutamate--ammonia ligase (EC 6.3.1.2) inhibitors chebi glutamate--ammonia ligase inhibitor ChEBI glutamate--ammonia ligase inhibitor chebi glutamate--ammonia ligase inhibitors ChEBI glutamate--ammonia ligase inhibitors chebi glutamine synthetase inhibitor ChEBI glutamine synthetase inhibitor chebi glutamine synthetase inhibitors ChEBI glutamine synthetase inhibitors chebi glutamylhydroxamic synthetase inhibitor ChEBI glutamylhydroxamic synthetase inhibitor chebi glutamylhydroxamic synthetase inhibitors ChEBI glutamylhydroxamic synthetase inhibitors chebi A dicarboxylic acid anion obtained by deprotonation of at least one of the carboxy groups of glutaric acid. chebi_ontology glutarate anion glutarates glutaric acid anion CHEBI:24329 glutarate glutarate anion chebi glutarates chebi glutaric acid anion chebi Any ether having glyceryl as at least one of the <em>O</em>-substituents. chebi_ontology CHEBI:24353 glycerol ether A proteinogenic amino acid derivative resulting from reaction of glycine at the amino group or the carboxy group, or from the replacement of any hydrogen of glycine by a heteroatom. chebi_ontology CHEBI:24373 glycine derivative chebi_ontology CHEBI:24384 glycogens A glycosphingolipid is a glycolipid that is a carbohydrate-containing derivative of a sphingoid or ceramide. It is understood that the carbohydrate residue is attached by a glycosidic linkage to O-1 of the sphingoid. CHEBI:5498 Wikipedia:Glycosphingolipid chebi_ontology glycosphingolipids CHEBI:24402 glycosphingolipid glycosphingolipids ChEBI glycosphingolipids chebi A chemical entity is a physical entity of interest in chemistry including molecular entities, parts thereof, and chemical substances. chemical entity chebi_ontology protein chemical entity CHEBI:24431 chemical entity chemical entity UniProt chemical entity uniprot_ft A role played by the molecular entity or part thereof within a biological context. chebi_ontology biological function CHEBI:24432 biological role biological function ChEBI biological function chebi A defined linked collection of atoms or a single atom within a molecular entity. chebi_ontology Gruppe Rest groupe grupo grupos CHEBI:24433 group Gruppe ChEBI Gruppe chebi Rest ChEBI Rest chebi groupe IUPAC groupe iupac grupo IUPAC grupo iupac grupos IUPAC grupos iupac Any organonitrogen compound containing a carbamimidamido (guanidino) group. Guanidines have the general structure (R<small>^1</small>R<small>^2</small>N)(R<small>^3</small>R<small>^4</small>N)C=N-R<small>^5</small> and are related structurally to amidines and ureas. chebi_ontology CHEBI:24436 guanidines Any non-proteinogenic amino acid carrying at least one halo group. chebi_ontology haloamino acids CHEBI:24470 haloamino acid haloamino acids chebi chebi_ontology halogen compounds halogen molecular entities halogen molecular entity CHEBI:24471 halogen molecular entity halogen compounds chebi halogen molecular entities chebi halogen molecular entity chebi chebi_ontology Halogene group 17 elements group VII elements halogene halogenes halogeno halogenos CHEBI:24473 halogen Halogene chebi group 17 elements chebi group VII elements chebi halogene chebi halogenes chebi halogeno chebi halogenos chebi A cyclic compound having as ring members atoms of carbon and at least of one other element. chebi_ontology organic heterocycle organic heterocyclic compounds CHEBI:24532 organic heterocyclic compound organic heterocycle ChEBI organic heterocycle chebi organic heterocyclic compounds ChEBI organic heterocyclic compounds chebi A heterodetic cyclic peptide is a peptide consisting only of amino-acid residues, but in which the linkages forming the ring are not solely peptide bonds; one or more is an isopeptide, disulfide, ester, or other bond. chebi_ontology heterodetic cyclic peptides peptide cyclique heterodetique peptido ciclico heterodetico CHEBI:24533 heterodetic cyclic peptide heterodetic cyclic peptides ChEBI heterodetic cyclic peptides chebi peptide cyclique heterodetique IUPAC peptide cyclique heterodetique iupac peptido ciclico heterodetico IUPAC peptido ciclico heterodetico iupac Any 6-carbon amino monosaccharide with at least one alcoholic hydroxy group replaced by an amino group. chebi_ontology hexosamine hexosamines CHEBI:24586 hexosamine hexosamine chebi hexosamines chebi chebi_ontology homocysteines CHEBI:24610 homocysteines homocysteines chebi Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds. chebi_ontology endocrine hormones CHEBI:24621 hormone endocrine ChEBI endocrine chebi hormones ChEBI hormones chebi A compound consisting of carbon and hydrogen only. chebi_ontology Kohlenwasserstoff Kohlenwasserstoffe hidrocarburo hidrocarburos hydrocarbure CHEBI:24632 hydrocarbon Kohlenwasserstoff ChEBI Kohlenwasserstoff chebi Kohlenwasserstoffe ChEBI Kohlenwasserstoffe chebi hidrocarburo IUPAC hidrocarburo iupac hidrocarburos IUPAC hidrocarburos iupac hydrocarbure IUPAC hydrocarbure iupac Mono-hydroperoxy (e)icosatetraenoic acids (HPETEs) are the primary products of lipoxygenase-catalysed oxygenation of arachidonic acid. chebi_ontology HPETEs Mono-hydroperoxy icosatetraenoic acids CHEBI:24644 HPETE HPETEs chebi Mono-hydroperoxy icosatetraenoic acids chebi Hydroxides are chemical compounds containing a hydroxy group or salts containing hydroxide (OH(-)). Hydroxides are chemical compounds containing a hydroxy group or salts containing hydroxide (OH<small>^−</small>). chebi_ontology CHEBI:24651 hydroxides A non-proteinogenic α-amino acid bearing one or more hydroxy groups at unspecified positions. chebi_ontology CHEBI:24662 hydroxy-amino acid Any member of the class of 5beta-cholanic acids carrying at least one hydroxy group at unspecified position. hydroxy-5beta-cholanic acids CHEBI:24663 hydroxy-5beta-cholanic acid hydroxy-5beta-cholanic acids ChEBI Any carboxylic acid with at least one hydroxy group. chebi_ontology hydroxy carboxylic acids hydroxycarboxylic acid hydroxycarboxylic acids CHEBI:24669 hydroxy carboxylic acid hydroxy carboxylic acids chebi hydroxycarboxylic acid chebi hydroxycarboxylic acids chebi chebi_ontology -CH2-OH serine side-chain CHEBI:24712 hydroxymethyl group -CH2-OH iupac serine side-chain chebi A proline derivative that is proline substituted by at least one hydroxy group. chebi_ontology hydroxyprolines CHEBI:24741 hydroxyproline hydroxyprolines chebi A five-membered organic heterocycle containing two nitrogen atoms at positions 1 and 3, or any of its derivatives; compounds containing an imidazole skeleton. chebi_ontology CHEBI:24780 imidazoles Any compound containing an indole skeleton. chebi_ontology CHEBI:24828 indoles A compound which contains oxygen, at least one other element, and at least one hydrogen bound to oxygen, and which produces a conjugate base by loss of positive hydrogen ion(s) (hydrons). chebi_ontology oxacids oxiacids oxo acid oxy-acids oxyacids CHEBI:24833 oxoacid oxacids ChEBI oxacids chebi oxiacids ChEBI oxiacids chebi oxo acid ChEBI oxo acid chebi oxy-acids ChEBI oxy-acids chebi oxyacids ChEBI oxyacids chebi chebi_ontology inorganic anions CHEBI:24834 inorganic anion inorganic anions ChEBI inorganic anions chebi A molecular entity that contains no carbon. chebi_ontology anorganische Verbindungen inorganic compounds inorganic entity inorganic molecular entities inorganics CHEBI:24835 inorganic molecular entity anorganische Verbindungen ChEBI anorganische Verbindungen chebi inorganic compounds ChEBI inorganic compounds chebi inorganic entity ChEBI inorganic entity chebi inorganic molecular entities ChEBI inorganic molecular entities chebi inorganics ChEBI inorganics chebi chebi_ontology inorganic oxides CHEBI:24836 inorganic oxide inorganic oxides ChEBI inorganic oxides chebi Compounds of structure ROOR' in which R and R' are inorganic groups. chebi_ontology inorganic peroxide inorganic peroxides CHEBI:24837 inorganic peroxide inorganic peroxide chebi inorganic peroxides chebi anorganisches Salz inorganic salts CHEBI:24839 inorganic salt anorganisches Salz ChEBI inorganic salts ChEBI Chemical element with atomic number 53. chebi_ontology 53I I Iod J Jod iode iodine iodium yodo CHEBI:24859 iodine atom 53I iupac I chebi Iod chebi J chebi Jod chebi iode chebi iodine chebi iodium chebi yodo chebi chebi_ontology iodine compounds iodine molecular entities iodine molecular entity CHEBI:24860 iodine molecular entity iodine compounds chebi iodine molecular entities chebi iodine molecular entity chebi An amino acid containing at least one iodo substituent. chebi_ontology CHEBI:24862 iodoamino acid chebi_ontology CHEBI:24863 iodophenol An iodoamino acid in which the amino acid specified is thyronine. chebi_ontology iodothyronines CHEBI:24864 iodothyronine iodothyronines chebi A salt is an assembly of cations and anions. chebi_ontology Salz Salze ionic compound ionic compounds sal sales salts sel sels CHEBI:24866 salt Salz ChEBI Salz chebi Salze ChEBI Salze chebi ionic compound ChEBI ionic compound chebi ionic compounds ChEBI ionic compounds chebi sal ChEBI sal chebi sales ChEBI sales chebi salts ChEBI salts chebi sel ChEBI sel chebi sels ChEBI sels chebi chebi_ontology monoatomic ions CHEBI:24867 monoatomic ion monoatomic ions ChEBI monoatomic ions chebi chebi_ontology organic salts organisches Salz CHEBI:24868 organic salt organic salts ChEBI organic salts chebi organisches Salz ChEBI organisches Salz chebi A molecular entity having a net electric charge. Ion chebi_ontology Ion Ionen ion iones ions CHEBI:24870 ion Ion ChEBI Ion chebi Ionen ChEBI Ionen chebi ion chebi iones ChEBI iones chebi ions ChEBI ions chebi iron molecular entity chebi_ontology iron compounds iron molecular entities iron molecular entity CHEBI:24873 iron molecular entity iron molecular entity ChEBI iron compounds ChEBI iron compounds chebi iron molecular entities ChEBI iron molecular entities chebi iron molecular entity chebi Fe cation iron cations CHEBI:24875 iron cation Fe cation UniProt iron cations ChEBI A 2-amino-3-methylpentanoic acid having either (2<i>R</i>,3<i>R</i>)- or (2<i>S</i>,3<i>S</i>)-configuration. chebi_ontology Hile rel-(2R,3R)-2-amino-3-methylpentanoic acid CHEBI:24898 isoleucine Hile iupac rel-(2R,3R)-2-amino-3-methylpentanoic acid iupac Any lipid formally derived from isoprene (2-methylbuta-1,3-diene), the skeleton of which can generally be discerned in repeated occurrence in the molecule. The skeleton of isoprenoids may differ from strict additivity of isoprene units by loss or shift of a fragment, commonly a methyl group. The class includes both hydrocarbons and oxygenated derivatives. isoprenoid chebi_ontology isoprenoid isoprenoids CHEBI:24913 isoprenoid isoprenoid ChEBI isoprenoid chebi isoprenoids ChEBI isoprenoids chebi Any alkaloid that has a structure based on an isoquinoline nucleus. They are derived from the amino acids like tyrosine and phenylalanine. chebi_ontology isoquinoline alkaloids CHEBI:24921 isoquinoline alkaloid isoquinoline alkaloids chebi chebi_ontology ketoaldonate ketoaldonates CHEBI:24961 ketoaldonate ketoaldonate chebi ketoaldonates chebi Oxo carboxylic acids formally derived from aldonic acids by replacement of a secondary CHOH group by a carbonyl group. chebi_ontology ketoaldonic acid ketoaldonic acids CHEBI:24963 ketoaldonic acid ketoaldonic acid chebi ketoaldonic acids chebi Cyclic amides of amino carboxylic acids, having a 1-azacycloalkan-2-one structure, or analogues having unsaturation or heteroatoms replacing one or more carbon atoms of the ring. chebi_ontology Laktam Laktame lactam lactams CHEBI:24995 lactam Laktam chebi Laktame chebi lactam iupac lactams chebi A hydroxy monocarboxylic acid anion that is the conjugate base of lactic acid, arising from deprotonation of the carboxy group. chebi_ontology 2-hydroxypropanoic acid, ion(1-) 2-hydroxypropionate MeCH(OH)CO2 anion b-lactate beta-lactate lactate CHEBI:24996 lactate 2-hydroxypropanoic acid, ion(1-) chemidplus 2-hydroxypropionate chemidplus MeCH(OH)CO2 anion nist b-lactate chebi beta-lactate chebi lactate uniprot_ft Any cyclic carboxylic ester containing a 1-oxacycloalkan-2-one structure, or an analogue having unsaturation or heteroatoms replacing one or more carbon atoms of the ring. chebi_ontology Lacton Lakton Laktone lactona lactonas CHEBI:25000 lactone Lacton chebi Lakton chebi Laktone chebi lactona iupac lactonas iupac A branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the α-carbon is substituted by an isobutyl group. chebi_ontology (+-)-Leucine (RS)-Leucine 2-amino-4-methylpentanoic acid DL-Leucine Hleu L Leu Leucin Leuzin CHEBI:25017 leucine (+-)-Leucine chemidplus (RS)-Leucine chemidplus 2-amino-4-methylpentanoic acid iupac DL-Leucine chemidplus Hleu iupac L chebi Leu chebi Leucin chebi Leuzin chebi Any icosanoid from that family of C<small>₂₀</small> polyunsaturated fatty acids and their derivatives generated by leukocytes from arachidonic acid, each member having four double bonds of which three are conjugated. chebi_ontology Leukotrien Leukotriene leucotriene leucotrienes leukotriene leukotrienes CHEBI:25029 leukotriene Leukotrien chebi Leukotriene chebi leucotriene chebi leucotrienes chebi leukotriene chebi leukotrienes chebi chebi_ontology linear tetrapyrroles CHEBI:25046 linear tetrapyrrole linear tetrapyrroles chebi A diamino acid that is caproic (hexanoic) acid bearing two amino substituents at positions 2 and 6. chebi_ontology K LYS Lysin alpha,epsilon-diaminocaproic acid CHEBI:25094 lysine K chebi LYS chebi Lysin chebi alpha,epsilon-diaminocaproic acid chebi chebi_ontology 12Mg Magnesium Mg magnesio magnesium CHEBI:25107 magnesium atom 12Mg iupac Magnesium chebi Mg iupac uniprot_ft magnesio chebi magnesium chebi Any intermediate or product resulting from metabolism. The term 'metabolite' subsumes the classes commonly known as primary and secondary metabolites. CHEBI:26619 CHEBI:35220 chebi_ontology metabolites primary metabolites secondary metabolites CHEBI:25212 metabolite metabolites ChEBI metabolites chebi primary metabolites ChEBI primary metabolites chebi secondary metabolites ChEBI secondary metabolites chebi chebi_ontology a metal cation metal cations CHEBI:25213 metal cation a metal cation UniProt a metal cation uniprot_ft metal cations ChEBI metal cations chebi chebi_ontology metalloporphyrins metaloporphyrins CHEBI:25216 metalloporphyrin metalloporphyrins chebi metaloporphyrins chebi An organosulfonic ester resulting from the formal condensation of methanesulfonic acid with the hydroxy group of an alcohol, phenol, heteroarenol, or enol. chebi_ontology mesylate ester mesylate esters methanesulfonic acid esters CHEBI:25223 methanesulfonate ester mesylate ester chebi mesylate esters chebi methanesulfonic acid esters chebi A 1,1-diunsubstituted alkanesulfonate that is the conjugate base of methanesulfonic acid. chebi_ontology methanesulfonate methylsulfonate CHEBI:25224 methanesulfonate methanesulfonate uniprot_ft methylsulfonate umbbd.compound A methanesulfonate ester resulting from the formal condensation of methanesulfonic acid with methanol. chebi_ontology CB1540 MMS Methanesulfonic acid methyl ester Methyl mesylate as-Dimethyl sulfite CHEBI:25255 methyl methanesulfonate CB1540 chebi MMS chemidplus kegg.compound Methanesulfonic acid methyl ester chemidplus Methyl mesylate chemidplus as-Dimethyl sulfite chemidplus chebi_ontology methylated amines CHEBI:25274 methylamines methylated amines chebi Mineralocorticoids are a class of steroid hormones that regulate water and electrolyte metabolism. chebi_ontology mineralocorticoids CHEBI:25354 mineralocorticoid mineralocorticoids ChEBI mineralocorticoids chebi chebi_ontology mitochondrial electron transport chain inhibitors mitochondrial electron-transport chain inhibitor mitochondrial respiratory chain inhibitors CHEBI:25355 mitochondrial respiratory-chain inhibitor mitochondrial electron transport chain inhibitors chebi mitochondrial electron-transport chain inhibitor chebi mitochondrial respiratory chain inhibitors chebi A molecule all atoms of which have the same atomic number. homoatomic molecule homoatomic molecules CHEBI:25362 elemental molecule homoatomic molecule ChEBI homoatomic molecules ChEBI Any polyatomic entity that is an electrically neutral entity consisting of more than one atom. molecule chebi_ontology Molekuel molecula molecule molecules neutral molecular compounds CHEBI:25367 molecule molecule IUPAC Molekuel ChEBI Molekuel chebi molecula IUPAC molecula iupac molecule iupac molecules IUPAC molecules iupac neutral molecular compounds IUPAC neutral molecular compounds iupac A group of neurotransmitters and neuromodulators that contain one amino group that is connected to an aromatic ring by ethylene group (-CH2-CH2-). Monoamines are derived from the aromatic amino acids phenylalanine, tyrosine, histidine and tryptophan. A group of neurotransmitters and neuromodulators that contain one amino group that is connected to an aromatic ring by ethylene group (‒CH<small>₂</small>‒CH<small>₂</small>‒). Monoamines are derived from the aromatic amino acids phenylalanine, tyrosine, histidine and tryptophan. chebi_ontology monamines monoamines CHEBI:25375 monoamine molecular messenger monamines ChEBI monamines chebi monoamines ChEBI monoamines chebi An oxoacid containing a single carboxy group. chebi_ontology monocarboxylic acids CHEBI:25384 monocarboxylic acid monocarboxylic acids ChEBI monocarboxylic acids chebi chebi_ontology monoatomic monocations monovalent inorganic cations CHEBI:25414 monoatomic monocation monoatomic monocations ChEBI monoatomic monocations chebi monovalent inorganic cations ChEBI monovalent inorganic cations chebi An isoquinoline alkaloid based on a morphinan skeleton and its substituted derivatives. chebi_ontology morphinane alkaloids CHEBI:25418 morphinane alkaloid morphinane alkaloids chebi An agent that increases the frequency of mutations above the normal background level, usually by interacting directly with DNA and causing it damage, including base substitution. chebi_ontology mutagene mutagenes mutagenic agent mutageno mutagenos mutagens CHEBI:25435 mutagen mutagene chebi mutagenes chebi mutagenic agent chebi mutageno chebi mutagenos chebi mutagens chebi chebi_ontology CHEBI:25500 neopterins An endogenous compound that is used to transmit information across the synapse between a neuron and another cell. Wikipedia:Neurotransmitter chebi_ontology neurotransmitters CHEBI:25512 neurotransmitter neurotransmitters ChEBI neurotransmitters chebi Any glycosphingolipid containing unsubstituted glycosyl moieties. CHEBI:7543 neutral glycosphingolipids CHEBI:25513 neutral glycosphingolipid neutral glycosphingolipids ChEBI WebElements:N chebi_ontology 7N N Stickstoff azote nitrogen nitrogeno CHEBI:25555 nitrogen atom 7N IUPAC 7N iupac N IUPAC N iupac Stickstoff ChEBI Stickstoff chebi azote IUPAC azote iupac nitrogen ChEBI nitrogen chebi nitrogeno ChEBI nitrogeno chebi chebi_ontology HNO2 [NO(OH)] nitrosyl hydroxide CHEBI:25567 nitrous acid HNO2 iupac [NO(OH)] iupac nitrosyl hydroxide nist chebi_ontology Nichtmetall Nichtmetalle no metal no metales non-metal non-metaux nonmetal nonmetals CHEBI:25585 nonmetal atom Nichtmetall ChEBI Nichtmetall chebi Nichtmetalle ChEBI Nichtmetalle chebi no metal ChEBI no metal chebi no metales ChEBI no metales chebi non-metal ChEBI non-metal chebi non-metaux ChEBI non-metaux chebi nonmetal ChEBI nonmetal chebi nonmetals ChEBI nonmetals chebi A nucleobase-containing molecular entity that is a nucleoside in which one or more of the sugar hydroxy groups has been converted into a mono- or poly-phosphate. The term includes both nucleotides and non-nucleotide nucleoside phosphates. KEGG:C01329 chebi_ontology NMP nucleoside phosphates CHEBI:25608 nucleoside phosphate NMP KEGG_COMPOUND NMP kegg.compound nucleoside phosphates ChEBI nucleoside phosphates chebi A peptide containing a relatively small number of amino acids. CHEBI:7755 chebi_ontology Oligopeptid oligopeptido CHEBI:25676 oligopeptide Oligopeptid chebi oligopeptido chebi chebi_ontology organic heteromonocyclic compounds CHEBI:25693 organic heteromonocyclic compound organic heteromonocyclic compounds ChEBI organic heteromonocyclic compounds chebi Any organic ion with a net negative charge. chebi_ontology organic anions CHEBI:25696 organic anion organic anions ChEBI organic anions chebi Any organic ion with a net positive charge. chebi_ontology organic cations CHEBI:25697 organic cation organic cations ChEBI organic cations chebi An organooxygen compound with formula ROR, where R is not hydrogen. chebi_ontology ethers CHEBI:25698 ether ethers chebi chebi_ontology organic ions CHEBI:25699 organic ion organic ions ChEBI organic ions chebi An oxide in which the oxygen atom is bonded to a carbon atom. chebi_ontology organic oxides CHEBI:25701 organic oxide organic oxides ChEBI organic oxides chebi Wikipedia:Organophosphate organic phosphate chebi_ontology organic phosphate organic phosphate ester organic phosphate esters organic phosphates organophosphate ester organophosphate esters CHEBI:25703 organic phosphate organic phosphate ChEBI organic phosphate chebi organic phosphate ester ChEBI organic phosphate ester chebi organic phosphate esters ChEBI organic phosphate esters chebi organic phosphates ChEBI organic phosphates chebi organophosphate ester ChEBI organophosphate ester chebi organophosphate esters ChEBI organophosphate esters chebi Compounds of the general formula SO3HOR where R is an organyl group chebi_ontology organic sulfates CHEBI:25704 organic sulfate organic sulfates ChEBI organic sulfates chebi An alcohol derived from an aliphatic compound. chebi_ontology Aliphatic alcohol aliphatic alcohols an aliphatic alcohol CHEBI:2571 aliphatic alcohol Aliphatic alcohol kegg.compound aliphatic alcohols chebi an aliphatic alcohol uniprot_ft An organophosphorus compound is formally a compound containing at least one carbon-phosphorus bond, but the term is often extended to include esters and thioesters. Wikipedia:Organophosphorus_compound organophosphorus compound chebi_ontology organophosphorus compound organophosphorus compounds CHEBI:25710 organophosphorus compound organophosphorus compound ChEBI organophosphorus compound chebi organophosphorus compounds ChEBI organophosphorus compounds chebi A solute used by a cell under water stress to maintain cell volume. chebi_ontology osmolytes CHEBI:25728 osmolyte osmolytes chebi An oxide is a chemical compound of oxygen with other chemical elements. oxide chebi_ontology oxide oxides CHEBI:25741 oxide oxide ChEBI oxide chebi oxides ChEBI oxides chebi Any compound that has an aldehydic or ketonic group as well as a carboxylic acid group in the same molecule. oxo acids oxo carboxylic acids CHEBI:25754 oxo carboxylic acid oxo acids IUPAC oxo carboxylic acids ChEBI Any fatty acid anion containing at least one C-C unsaturated bond; formed by deprotonation of the carboxylic acid moiety. chebi_ontology CHEBI:2580 unsaturated fatty acid anion KEGG:C00007 WebElements:O chebi_ontology 8O O Sauerstoff oxigeno oxygen oxygene CHEBI:25805 oxygen atom 8O IUPAC 8O iupac O IUPAC O iupac Sauerstoff ChEBI Sauerstoff chebi oxigeno ChEBI oxigeno chebi oxygen ChEBI oxygen chebi oxygene ChEBI oxygene chebi oxygen molecular entity chebi_ontology oxygen molecular entities oxygen molecular entity CHEBI:25806 oxygen molecular entity oxygen molecular entity ChEBI oxygen molecular entities ChEBI oxygen molecular entities chebi oxygen molecular entity chebi chebi_ontology oxopurines CHEBI:25810 oxopurine oxopurines chebi aldopentose phosphate chebi_ontology aldopentose phosphate aldopentose phosphates CHEBI:25900 aldopentose phosphate aldopentose phosphate ChEBI aldopentose phosphate chebi aldopentose phosphates ChEBI aldopentose phosphates chebi A five-carbon monosaccharide which in its linear form contains either an aldehyde group at position 1 (aldopentose) or a ketone group at position 2 (ketopentose). pentose chebi_ontology pentose pentoses CHEBI:25901 pentose pentose ChEBI pentose chebi pentoses ChEBI pentoses chebi Any peptide with hormonal activity in animals, whether endocrine, neuroendocrine, or paracrine. chebi_ontology peptide hormones polypeptide hormone CHEBI:25905 peptide hormone peptide hormones ChEBI peptide hormones chebi polypeptide hormone ChEBI polypeptide hormone chebi Compounds of structure ROOR'. chebi_ontology a peroxide CHEBI:25940 peroxides a peroxide uniprot_ft An amino acid derivative resulting from reaction of alanine at the amino group or the carboxy group, or from the replacement of any hydrogen of phenylalanine by a heteroatom. The definition normally excludes peptides containing phenylalanine residues. chebi_ontology CHEBI:25985 phenylalanine derivative Salts and esters of phosphoric and oligophosphoric acids and their chalcogen analogues. In inorganic chemistry, the term is also used to describe anionic coordination entities with phosphorus as central atom. chebi_ontology phosphates CHEBI:26020 phosphate phosphates ChEBI phosphates chebi phosphoamino acids CHEBI:26051 phosphoamino acid phosphoamino acids ChEBI A phosphorus oxoacid that consists of one oxo and three hydroxy groups joined covalently to a central phosphorus atom. HMDB:HMDB0002142 KEGG:C00009 KEGG:D05467 KNApSAcK:C00007408 Wikipedia:Phosphoric_Acid Phosphoric acid phosphoric acid chebi_ontology H3PO4 Orthophosphoric acid Phosphate Phosphoric acid Phosphorsaeure Phosphorsaeureloesungen [PO(OH)3] acide phosphorique acidum phosphoricum orthophosphoric acid phosphoric acid CHEBI:26078 phosphoric acid Phosphoric acid KEGG_COMPOUND phosphoric acid IUPAC H3PO4 IUPAC H3PO4 iupac Orthophosphoric acid KEGG_COMPOUND Orthophosphoric acid kegg.compound Phosphate KEGG_COMPOUND Phosphate kegg.compound Phosphoric acid kegg.compound Phosphorsaeure ChEBI Phosphorsaeure chebi Phosphorsaeureloesungen ChEBI Phosphorsaeureloesungen chebi [PO(OH)3] IUPAC [PO(OH)3] iupac acide phosphorique ChEBI acide phosphorique chebi acidum phosphoricum ChEBI acidum phosphoricum chebi orthophosphoric acid NIST_Chemistry_WebBook orthophosphoric acid nist phosphoric acid iupac chebi_ontology phosphoric acid derivatives phosphoric acids CHEBI:26079 phosphoric acid derivative phosphoric acid derivatives chebi phosphoric acids chebi chebi_ontology phosphorus molecular entities CHEBI:26082 phosphorus molecular entity phosphorus molecular entities ChEBI phosphorus molecular entities chebi chebi_ontology phytosteroids CHEBI:26124 phytosteroid phytosteroids chebi Sterols similar to cholesterol which occur in plants and vary only in carbon side chains and/or presence or absence of a double bond. chebi_ontology CHEBI:26125 phytosterols Any amino acid whose side chain is capable of forming one or more hydrogen bonds. CHEBI:8283 MetaCyc:Polar-amino-acids polar amino acid chebi_ontology polar amino acid polar amino acids polar amino-acid polar amino-acids CHEBI:26167 polar amino acid polar amino acid ChEBI polar amino acid chebi polar amino acids ChEBI polar amino acids chebi polar amino-acid ChEBI polar amino-acid chebi polar amino-acids ChEBI polar amino-acids chebi A compound that contains two or more hydroxy groups. chebi_ontology polyols CHEBI:26191 polyol polyols chebi Any fatty acid containing more than one double bond. Acids in this group are reported to have cardioprotective effects; and levels are lowered in chronic fatigue syndrome. chebi_ontology PUFA PUFAs polyunsaturated fatty acids CHEBI:26208 polyunsaturated fatty acid PUFA chebi PUFAs chebi polyunsaturated fatty acids chebi Natural pigments containing a fundamental skeleton of four pyrrole nuclei united through the alpha-positions by four methine groups to form a macrocyclic structure. Natural pigments containing a fundamental skeleton of four pyrrole nuclei united through the α-positions by four methine groups to form a macrocyclic structure. Wikipedia:Porphyrin chebi_ontology CHEBI:26214 porphyrins DrugBank:DB01345 KEGG:C00238 WebElements:K chebi_ontology 19K K Kalium kalium potasio potassium CHEBI:26216 potassium atom 19K IUPAC 19K iupac K IUPAC K iupac Kalium ChemIDplus Kalium chemidplus kalium IUPAC kalium iupac potasio ChEBI potasio chebi potassium ChEBI potassium chebi potassium molecular entity potassium molecular entities CHEBI:26217 potassium molecular entity potassium molecular entity ChEBI potassium molecular entities ChEBI An α-amino acid that is pyrrolidine bearing a carboxy substituent at position 2. chebi_ontology DL-Proline Hpro Prolin prolina proline pyrrolidine-2-carboxylic acid CHEBI:26271 proline DL-Proline kegg.compound Hpro iupac Prolin chebi prolina chebi proline chebi pyrrolidine-2-carboxylic acid iupac An amino acid derivative resulting from reaction of proline at the amino group or the carboxy group, or from the replacement of any hydrogen of proline by a heteroatom. The definition normally excludes peptides containing proline residues. chebi_ontology proline derivatives CHEBI:26273 proline derivative proline derivatives chebi Naturally occurring compounds derived from the parent C<small>₂₀</small> acid, prostanoic acid. chebi_ontology prostaglandin prostaglandins CHEBI:26333 prostaglandin prostaglandin chebi prostaglandins chebi The family of natural prostaglandins and prostaglandin-like compounds including prostacyclins and thromboxanes. chebi_ontology prostanoid prostanoids CHEBI:26347 prostanoid prostanoid chebi prostanoids chebi A tightly bound, specific nonpolypeptide unit in a protein determining and involved in its biological activity. chebi_ontology groupe prosthetique prosthetic groups CHEBI:26348 prosthetic group groupe prosthetique iupac prosthetic groups chebi chebi_ontology CHEBI:26373 pteridines chebi_ontology CHEBI:26375 pterins A nucleobase whose skeleton is derived from purine. KEGG:C15587 purine nucleobase chebi_ontology a purine nucleobase purine bases purine nucleobase purine nucleobases CHEBI:26386 purine nucleobase purine nucleobase ChEBI a purine nucleobase UniProt a purine nucleobase uniprot_ft purine bases ChEBI purine bases chebi purine nucleobase chebi purine nucleobases ChEBI purine nucleobases chebi chebi_ontology purine nucleoside diphosphates CHEBI:26391 purine nucleoside diphosphate purine nucleoside diphosphates ChEBI purine nucleoside diphosphates chebi chebi_ontology purine nucleoside triphosphates CHEBI:26393 purine nucleoside triphosphate purine nucleoside triphosphates ChEBI purine nucleoside triphosphates chebi purine nucleoside chebi_ontology purine nucleoside purine nucleosides CHEBI:26394 purine nucleoside purine nucleoside ChEBI purine nucleoside chebi purine nucleosides ChEBI purine nucleosides chebi Any nucleotide that has a purine nucleobase. chebi_ontology purine nucleotides CHEBI:26395 purine nucleotide purine nucleotides ChEBI purine nucleotides chebi chebi_ontology purine ribonucleoside diphosphates CHEBI:26396 purine ribonucleoside diphosphate purine ribonucleoside diphosphates ChEBI purine ribonucleoside diphosphates chebi chebi_ontology purine ribonucleoside triphosphates CHEBI:26398 purine ribonucleoside triphosphate purine ribonucleoside triphosphates ChEBI purine ribonucleoside triphosphates chebi A ribonucleoside that has a purine moiety as the nucleobase (the R group in the illustration). chebi_ontology purine ribonucleosides CHEBI:26399 purine ribonucleoside purine ribonucleosides ChEBI purine ribonucleosides chebi Any ribonucleotide that has a purine nucleobase. chebi_ontology purine ribonucleotides CHEBI:26400 purine ribonucleotide purine ribonucleotides ChEBI purine ribonucleotides chebi A class of imidazopyrimidines that consists of purine and its substituted derivatives. CHEBI:13678 chebi_ontology CHEBI:26401 purines A nucleobase whose skeleton is derived from pyrimidine. chebi_ontology a pyrimidine nucleobase pyrimidine bases pyrimidine nucleobase pyrimidine nucleobases CHEBI:26432 pyrimidine nucleobase a pyrimidine nucleobase uniprot_ft pyrimidine bases chebi pyrimidine nucleobase chebi pyrimidine nucleobases chebi chebi_ontology pyrimidinemonocarboxylic acids CHEBI:26447 pyrimidinemonocarboxylic acid pyrimidinemonocarboxylic acids chebi A nitrogen molecular entity that is electronically neutral but which contains a quaternary nitrogen. chebi_ontology CHEBI:26469 quaternary nitrogen compound Molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers. chebi_ontology ROS CHEBI:26523 reactive oxygen species ROS chebi Oxygenated derivatives of 3,7-dimethyl-1-(2,6,6-trimethylcyclohex-1-enyl)nona-1,3,5,7-tetraene and derivatives thereof. chebi_ontology retinoid retinoids CHEBI:26537 retinoid retinoid chebi retinoids chebi chebi_ontology ribonucleotides CHEBI:26561 ribonucleotide ribonucleotides ChEBI ribonucleotides chebi ribose phosphate chebi_ontology ribose phosphate ribose phosphates CHEBI:26562 ribose phosphate ribose phosphate ChEBI ribose phosphate chebi ribose phosphates ChEBI ribose phosphates chebi Any fatty acid containing no carbon to carbon multiple bonds. Known to produce adverse biological effects when ingested to excess. saturated fatty acid chebi_ontology SFA SFAs saturated fatty acid saturated fatty acids CHEBI:26607 saturated fatty acid saturated fatty acid ChEBI SFA ChEBI SFA chebi SFAs ChEBI SFAs chebi saturated fatty acid chebi saturated fatty acids ChEBI saturated fatty acids chebi An α-amino acid which is biosynthesised from 3-phosphoglycerate (i.e. serine, glycine, cysteine and homocysteine). A closed class. chebi_ontology 3-phosphoglycerate family amino acid 3-phosphoglycerate family amino acids serine family amino acids CHEBI:26650 serine family amino acid 3-phosphoglycerate family amino acid chebi 3-phosphoglycerate family amino acids chebi serine family amino acids chebi An aliphatic monocarboxylic acid with a chain length of less than C6. If any non-hydrocarbon substituent is present, the compound is not normally regarded as a short-chain fatty acid. An aliphatic monocarboxylic acid with a chain length of less than C<small>₆</small>. If any non-hydrocarbon substituent is present, the compound is not normally regarded as a short-chain fatty acid. chebi_ontology SCFA SCFAs short-chain fatty acids CHEBI:26666 short-chain fatty acid SCFA ChEBI SCFA chebi SCFAs ChEBI SCFAs chebi short-chain fatty acids ChEBI short-chain fatty acids chebi KEGG:C01330 WebElements:Na chebi_ontology 11Na Na Natrium natrium sodio sodium CHEBI:26708 sodium atom 11Na IUPAC 11Na iupac Na IUPAC Na iupac Natrium ChemIDplus Natrium chemidplus natrium IUPAC natrium iupac sodio ChemIDplus sodio chemidplus sodium ChEBI sodium chebi chebi_ontology sodium compounds sodium molecular entities CHEBI:26712 sodium molecular entity sodium compounds ChEBI sodium compounds chebi sodium molecular entities ChEBI sodium molecular entities chebi Any alkali metal salt having sodium(1+) as the cation. chebi_ontology Natriumsalz Natriumsalze sodium salts CHEBI:26714 sodium salt Natriumsalz ChEBI Natriumsalz chebi Natriumsalze ChEBI Natriumsalze chebi sodium salts ChEBI sodium salts chebi A 2-aminooctadecene-1,3-diol having (2<i>S</i>,3<i>R</i>)-configuration. chebi_ontology sphingenines CHEBI:26738 sphingenine sphingenines chebi Sphingolipids are a complex family of compounds that share a common structural feature, a sphingoid base backbone. chebi_ontology sphingolipids CHEBI:26739 sphingolipid sphingolipids ChEBI sphingolipids chebi A sphingenine in which the C=C double bond is located at the 4-position. chebi_ontology 4-sphingenine sphing-4-enine CHEBI:26743 sphing-4-enine 4-sphingenine chebi sphing-4-enine iupac Any steroid that acts as hormone. chebi_ontology Steroidhormon Steroidhormone hormona esteroide hormonas esteroideas hormone steroide hormones steroides steroid hormones CHEBI:26764 steroid hormone Steroidhormon ChEBI Steroidhormon chebi Steroidhormone ChEBI Steroidhormone chebi hormona esteroide ChEBI hormona esteroide chebi hormonas esteroideas ChEBI hormonas esteroideas chebi hormone steroide ChEBI hormone steroide chebi hormones steroides ChEBI hormones steroides chebi steroid hormones ChEBI steroid hormones chebi chebi_ontology carbohydrate phosphates CHEBI:26816 carbohydrate phosphate carbohydrate phosphates ChEBI carbohydrate phosphates chebi An ester of an alcohol and sulfuric acid. chebi_ontology sulfate ester sulfuric acid ester sulfuric acid esters CHEBI:26819 sulfuric ester sulfate ester ChEBI sulfate ester chebi sulfuric acid ester ChEBI sulfuric acid ester chebi sulfuric acid esters ChEBI sulfuric acid esters chebi Salts and esters of sulfuric acid sulfates chebi_ontology sulfates sulfuric acid derivative sulphates CHEBI:26820 sulfates sulfates ChEBI sulfates chebi sulfuric acid derivative ChEBI sulfuric acid derivative chebi sulphates ChEBI sulphates chebi Any sulfur molecular entity that involves either covalently bonded or anionic sulfur. chebi_ontology sulphides CHEBI:26822 sulfide sulphides chebi A sulfate ester of a glycolipid. chebi_ontology sulfoglycolipids CHEBI:26829 sulfoglycolipid sulfoglycolipids chebi chebi_ontology sulfonium compounds CHEBI:26830 sulfonium compound sulfonium compounds chebi KEGG:C00087 KEGG:D06527 PPDB:605 WebElements:S chebi_ontology 16S Elemental sulfur S Schwefel azufre soufre sulfur sulphur theion CHEBI:26833 sulfur atom 16S IUPAC 16S iupac Elemental sulfur KEGG_COMPOUND Elemental sulfur kegg.compound S IUPAC KEGG_COMPOUND S iupac kegg.compound Schwefel ChEBI Schwefel chebi azufre ChEBI azufre chebi soufre ChEBI soufre chebi sulfur ChEBI UniProt sulfur chebi uniprot_ft sulphur ChEBI sulphur chebi theion IUPAC theion iupac chebi_ontology sulfur-containing amino acids CHEBI:26834 sulfur-containing amino acid sulfur-containing amino acids chebi sulfur molecular entity chebi_ontology sulfur molecular entities sulfur molecular entity CHEBI:26835 sulfur molecular entity sulfur molecular entity ChEBI sulfur molecular entities ChEBI sulfur molecular entities chebi sulfur molecular entity chebi A sulfur oxoacid that consists of two oxo and two hydroxy groups joined covalently to a central sulfur atom. KEGG:C00059 KEGG:D05963 KNApSAcK:C00007530 MolBase:4 PPDB:606 Wikipedia:Sulfuric_acid Sulfuric acid chebi_ontology Acide sulfurique Acido sulfurico Acidum sulfuricum H2SO4 Schwefelsaeureloesungen Sulfuric acid [S(OH)2O2] [SO2(OH)2] sulfuric acid sulphuric acid CHEBI:26836 sulfuric acid Sulfuric acid KEGG_COMPOUND Acide sulfurique ChemIDplus Acide sulfurique chemidplus Acido sulfurico ChemIDplus Acido sulfurico chemidplus Acidum sulfuricum ChemIDplus Acidum sulfuricum chemidplus H2SO4 IUPAC H2SO4 iupac Schwefelsaeureloesungen ChemIDplus Schwefelsaeureloesungen chemidplus Sulfuric acid kegg.compound [S(OH)2O2] MolBase [S(OH)2O2] molbase [SO2(OH)2] IUPAC [SO2(OH)2] iupac sulfuric acid chebi sulphuric acid MolBase sulphuric acid molbase Any isoprenoid that is a natural product or related compound formally derived from isoprene units. Terpenoids may contain oxygen in various functional groups. This class is subdivided according to the number of carbon atoms in the parent terpene. The skeleton of terpenoids may differ from strict additivity of isoprene units by the loss or shift of a fragment, generally a methyl group. chebi_ontology Terpenoid terpenoide terpenoides CHEBI:26873 terpenoid Terpenoid chebi terpenoide iupac terpenoides iupac Any oxacycle having an oxolane (tetrahydrofuran) skeleton. chebi_ontology CHEBI:26912 oxolanes A natural pigment containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next. chebi_ontology a tetrapyrrole CHEBI:26932 tetrapyrrole a tetrapyrrole UniProt a tetrapyrrole uniprot_ft Any member of the group of 1,3-thiazolium cations that exhibit biological activity against vitamin B<small>₁</small> deficiency in animals. Symptoms of vitamin B<small>₁</small> deficiency include constipation, loss of apetite, fatigue, nausea, delirium, blurry vision and muscle weakness. Severe vitamin B<small>₁</small> deficiency can also lead to a disease known as <a href="https://en.wikipedia.org/wiki/Thiamine_deficiency" target="_blank">beriberi</a>. Vitamin B<small>₁</small> consists of the vitamer thiamin and its acid, aldehyde and phosphorylated derivatives (and their corresponding ionized, salt and hydrate forms). chebi_ontology thiamine thiamines thiamins vitamin B1 vitamin B1 vitamer vitamin B1 vitamers vitamins B1 CHEBI:26948 vitamin B1 thiamine chebi thiamines chebi thiamins chebi vitamin B1 chebi vitamin B1 vitamer chebi vitamin B1 vitamers chebi vitamins B1 chebi An α-amino acid in which one of the hydrogens attached to the α-carbon of glycine is substituted by a 1-hydroxyethyl group. chebi_ontology Threonin CHEBI:26986 threonine Threonin chebi A class of oxygenated oxane derivatives, originally derived from prostaglandin precursors in platelets, that stimulate aggregation of platelets and constriction of blood vessels. chebi_ontology thromboxane thromboxanes CHEBI:26995 thromboxane thromboxane chebi thromboxanes chebi An <em>N</em>-acylethanolamine 20:4 resulting from the formal condensation of carboxy group of arachidonic acid with the amino group of ethanolamine. CHEBI:88116 chebi_ontology (5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)-5,8,11,14-eicosatetraenamide (all-Z)-N-(2-hydroxyethyl)-5,8,11,14-eicosatetraenamide AEA Anandamide Anandamide (20.4, N-6) Anandamide(20:4, N-6) Arachidonic acid N-(hydroxyethyl)amide Arachidonylethanolamide N-(2-Hydroxyethyl)anachidonamide N-(5Z,8Z,11Z,14Z-Eicosatetraenoyl)-ethanolamine N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine N-(5Z,8Z,11Z,14Z-icosatetraenoyl)-ethanolamide N-arachidonoyl ethanolamine N-arachidonoyl-2-hydroxyethylamide N-arachidonoylethanolamine arachidonoyl ethanolamide CHEBI:2700 anandamide (5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)-5,8,11,14-eicosatetraenamide chemidplus (all-Z)-N-(2-hydroxyethyl)-5,8,11,14-eicosatetraenamide chemidplus AEA kegg.compound Anandamide kegg.compound Anandamide (20.4, N-6) hmdb Anandamide(20:4, N-6) hmdb Arachidonic acid N-(hydroxyethyl)amide hmdb Arachidonylethanolamide kegg.compound N-(2-Hydroxyethyl)anachidonamide hmdb N-(5Z,8Z,11Z,14Z-Eicosatetraenoyl)-ethanolamine hmdb N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine uniprot_ft N-(5Z,8Z,11Z,14Z-icosatetraenoyl)-ethanolamide kegg.compound N-arachidonoyl ethanolamine hmdb N-arachidonoyl-2-hydroxyethylamide chemidplus N-arachidonoylethanolamine chebi arachidonoyl ethanolamide chemidplus Any member of the class of benzenes that is a substituted benzene in which the substituents include one (and only one) methyl group. chebi_ontology CHEBI:27024 toluenes Poisonous substance produced by a biological organism such as a microbe, animal or plant. chebi_ontology toxins CHEBI:27026 toxin toxins chebi Any nutrient required in small quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Wikipedia:Micronutrient chebi_ontology micronutrients trace elements CHEBI:27027 micronutrient micronutrients ChEBI micronutrients chebi trace elements ChEBI trace elements chebi An element whose atom has an incomplete d sub-shell, or which can give rise to cations with an incomplete d sub-shell. chebi_ontology Uebergangselement Uebergangsmetalle metal de transicion metal de transition metales de transicion metaux de transition transition element transition elements transition metal transition metals CHEBI:27081 transition element atom Uebergangselement ChEBI Uebergangselement chebi Uebergangsmetalle ChEBI Uebergangsmetalle chebi metal de transicion ChEBI metal de transicion chebi metal de transition ChEBI metal de transition chebi metales de transicion ChEBI metales de transicion chebi metaux de transition ChEBI metaux de transition chebi transition element ChEBI transition element chebi transition elements ChEBI transition elements chebi transition metal ChEBI transition metal chebi transition metals ChEBI transition metals chebi chebi_ontology tricarboxylate tricarboxylates tricarboxylic acid trianions CHEBI:27092 tricarboxylic acid trianion tricarboxylate chebi tricarboxylates chebi tricarboxylic acid trianions chebi An oxoacid containing three carboxy groups. chebi_ontology Tricarbonsaeure Trikarbonsaeure tricarboxylic acids CHEBI:27093 tricarboxylic acid Tricarbonsaeure chebi Trikarbonsaeure chebi tricarboxylic acids chebi A chemical compound containing three hydroxy groups. chebi_ontology triols CHEBI:27136 triol triols chebi Tryptamine and its substitution derivatives. chebi_ontology CHEBI:27162 tryptamines chebi_ontology heterobicyclic compounds organic heterobicyclic compounds CHEBI:27171 organic heterobicyclic compound heterobicyclic compounds ChEBI heterobicyclic compounds chebi organic heterobicyclic compounds ChEBI organic heterobicyclic compounds chebi A proteinogenic amino acid derivative resulting from reaction of L-tyrosine at the amino group or the carboxy group, or from the replacement of any hydrogen of L-tyrosine by a heteroatom. L-tyrosine derivatives CHEBI:27177 L-tyrosine derivative L-tyrosine derivatives ChEBI A univalent carboacyl group is a group formed by loss of OH from the carboxy group of a carboxylic acid. chebi_ontology univalent acyl group univalent carboacyl groups univalent carboxylic acyl groups CHEBI:27207 univalent carboacyl group univalent acyl group ChEBI univalent acyl group chebi univalent carboacyl groups ChEBI univalent carboacyl groups chebi univalent carboxylic acyl groups ChEBI univalent carboxylic acyl groups chebi Any fatty acid containing at least one C=C or C≡C bond. chebi_ontology alkene acid olefinic acid unsaturated fatty acids CHEBI:27208 unsaturated fatty acid alkene acid chebi olefinic acid chebi unsaturated fatty acids chebi lipidmaps chebi_ontology urate dianion CHEBI:27216 urate(2-) urate dianion chebi An oxopurine that is the final oxidation product of purine metabolism. chebi_ontology uric acids CHEBI:27226 uric acid uric acids chebi A branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the α-carbon is substituted by an isopropyl group. chebi_ontology 2-amino-3-methylbutanoic acid DL-valine Hval Valin valina CHEBI:27266 valine 2-amino-3-methylbutanoic acid iupac DL-valine chebi Hval iupac Valin chebi valina chebi Any member of a group of fat-soluble hydroxy seco-steroids that exhibit biological activity against vitamin D deficiency. Vitamin D can be obtained from sun exposure, food and supplements and is biologically inactive and converted into the biologically active calcitriol via double hydroxylation in the body. chebi_ontology D vitamins vitamin D vitamer vitamin D vitamers vitamin Ds vitamins D CHEBI:27300 vitamin D D vitamins chebi vitamin D vitamer chebi vitamin D vitamers chebi vitamin Ds chebi vitamins D chebi Any vitamin that dissolves in water and readily absorbed into tissues for immediate use. Unlike the fat-soluble vitamins, they are not stored in the body and need to be replenished regularly in the diet and will rarely accumulate to toxic levels since they are quickly excreted from the body via urine. chebi_ontology wasserloesliche Vitamine water-soluble vitamin water-soluble vitamins CHEBI:27314 water-soluble vitamin (role) wasserloesliche Vitamine chebi water-soluble vitamin chebi water-soluble vitamins chebi chebi_ontology 30Zn Zink Zn Zn(II) Zn2+ cinc zinc zincum CHEBI:27363 zinc atom 30Zn iupac Zink chebi Zn iupac Zn(II) kegg.compound Zn2+ kegg.compound cinc chebi zinc chebi zincum chebi A neutral compound having formal unit electrical charges of opposite sign on non-adjacent atoms. Sometimes referred to as inner salts, dipolar ions (a misnomer). chebi_ontology compose zwitterionique compuestos zwitterionicos zwitteriones zwitterionic compounds CHEBI:27369 zwitterion compose zwitterionique IUPAC compose zwitterionique iupac compuestos zwitterionicos IUPAC compuestos zwitterionicos iupac zwitteriones IUPAC zwitteriones iupac zwitterionic compounds IUPAC zwitterionic compounds iupac An alkanesulfonic acid in which the alkyl group directly linked to the sulfo functionality is methyl. CHEBI:6813 Methanesulfonic acid chebi_ontology Methanesulfonic acid Methansulfonsaeure methylsulfonic acid CHEBI:27376 methanesulfonic acid Methanesulfonic acid KEGG_COMPOUND Methanesulfonic acid kegg.compound Methansulfonsaeure chebi methylsulfonic acid nist An <em>N</em>-acyl-amino acid that is a form of the water-soluble vitamin B<small>₉</small>. Its biologically active forms (tetrahydrofolate and others) are essential for nucleotide biosynthesis and homocysteine remethylation. CHEBI:24075 CHEBI:42610 CHEBI:5140 CHEBI:569217 chebi_ontology (2S)-2-(4-{[(2-amino-4-oxo-3,4-dihydropteridin-6-yl)methyl]amino}benzamido)pentanedioic acid Folate Folsaeure N-[(4-{[(2-amino-4-oxo-1,4-dihydropteridin-6-yl)methyl]amino}phenyl)carbonyl]-L-glutamic acid N-pteroyl-L-glutamic acid PGA PteGlu pteroyl-L-glutamic acid pteroyl-L-monoglutamic acid pteroylglutamic acid pteroylmonoglutamic acid vitamin B11 vitamin B9 vitamin Bc vitamin Be vitamin M CHEBI:27470 folic acid (2S)-2-(4-{[(2-amino-4-oxo-3,4-dihydropteridin-6-yl)methyl]amino}benzamido)pentanedioic acid iupac Folate kegg.compound Folsaeure chebi N-[(4-{[(2-amino-4-oxo-1,4-dihydropteridin-6-yl)methyl]amino}phenyl)carbonyl]-L-glutamic acid pdb-ccd N-pteroyl-L-glutamic acid chebi PGA nist PteGlu nist pteroyl-L-glutamic acid chemidplus pteroyl-L-monoglutamic acid chemidplus pteroylglutamic acid kegg.compound pteroylmonoglutamic acid chemidplus vitamin B11 chemidplus vitamin B9 chemidplus vitamin Bc chemidplus vitamin Be chemidplus vitamin M chemidplus CHEBI:26627 CHEBI:9091 Selenium chebi_ontology 34Se Se Selen Selenium selenio selenium CHEBI:27568 selenium atom Selenium KEGG_COMPOUND 34Se iupac Se iupac Selen chemidplus Selenium kegg.compound selenio chebi selenium chebi An α-amino acid that is propanoic acid bearing an amino substituent at position 2 and a 1<em>H</em>-imidazol-4-yl group at position 3. CHEBI:24598 CHEBI:43118 CHEBI:5733 Histidine chebi_ontology DL-Histidine Histidin Histidine alpha-Amino-1H-imidazole-4-propionic acid histidina CHEBI:27570 histidine Histidine KEGG_COMPOUND DL-Histidine kegg.compound Histidin chebi Histidine kegg.compound alpha-Amino-1H-imidazole-4-propionic acid kegg.compound histidina chebi A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure. The overall effect of aldosterone is to increase reabsorption of ions and water in the kidney. CHEBI:22306 CHEBI:2563 CHEBI:40919 DrugBank:DB04630 HMDB:HMDB0000037 KEGG:C01780 LINCS:LSM-42770 PDBeChem:AS4 Wikipedia:Aldosterone ALDOSTERONE Aldosterone aldosterone chebi_ontology (+)-aldosterone (11beta)-11,21-dihydroxy-3,20-dioxopregn-4-en-18-al 11beta,21-Dihydroxy-3,20-dioxo-4-pregnen-18-al ALDOSTERONE Aldosterone aldosterone CHEBI:27584 aldosterone ALDOSTERONE PDBeChem Aldosterone KEGG_COMPOUND aldosterone UniProt (+)-aldosterone NIST_Chemistry_WebBook (+)-aldosterone nist (11beta)-11,21-dihydroxy-3,20-dioxopregn-4-en-18-al NIST_Chemistry_WebBook (11beta)-11,21-dihydroxy-3,20-dioxopregn-4-en-18-al nist 11beta,21-Dihydroxy-3,20-dioxo-4-pregnen-18-al KEGG_COMPOUND 11beta,21-Dihydroxy-3,20-dioxo-4-pregnen-18-al kegg.compound ALDOSTERONE pdb-ccd Aldosterone kegg.compound aldosterone uniprot_ft CHEBI:23009 CHEBI:3399 KEGG:C06265 WebElements:C Carbon chebi_ontology 6C C Carbon Kohlenstoff carbon carbone carbonium carbono CHEBI:27594 carbon atom Carbon KEGG_COMPOUND 6C IUPAC 6C iupac C IUPAC KEGG_COMPOUND C iupac kegg.compound Carbon KEGG_COMPOUND Carbon kegg.compound Kohlenstoff ChEBI Kohlenstoff chebi carbon ChEBI carbon chebi carbone ChEBI carbone chebi carbonium ChEBI carbonium chebi carbono ChEBI carbono chebi A surfactant (or a mixture containing one or more surfactants) having cleaning properties in dilute solutions. CHEBI:23648 CHEBI:4456 chebi_ontology Detergents CHEBI:27780 detergent Detergents kegg.compound An α-amino acid that is alanine bearing an indol-3-yl substituent at position 3. CHEBI:27163 CHEBI:9769 Tryptophan chebi_ontology 2-amino-3-(1H-indol-3-yl)propanoic acid Htrp Trp Tryptophan W alpha-Amino-beta-(3-indolyl)-propionic acid alpha-amino-beta-3-indolepropionic acid beta-3-indolylalanine triptofano tryptophane CHEBI:27897 tryptophan Tryptophan KEGG_COMPOUND 2-amino-3-(1H-indol-3-yl)propanoic acid iupac Htrp iupac Trp chebi Tryptophan kegg.compound W chebi alpha-Amino-beta-(3-indolyl)-propionic acid kegg.compound alpha-amino-beta-3-indolepropionic acid chebi beta-3-indolylalanine chebi triptofano chebi tryptophane chebi The most important reserve polysaccharide found in plants. It is a glucan consisting of amylose and amylopectin. CHEBI:26750 CHEBI:26751 CHEBI:9251 KEGG:C00369 KEGG:D06507 KEGG:G10545 Wikipedia:Starch Starch Staerke amidon amylum CHEBI:28017 starch Starch KEGG_COMPOUND Staerke ChEBI amidon ChEBI amylum ChEBI An aromatic amino acid that is alanine in which one of the methyl hydrogens is substituted by a phenyl group. CHEBI:25984 CHEBI:8089 KEGG:C02057 Wikipedia:Phenylalanine Phenylalanine chebi_ontology DL-Phenylalanine F PHE Phenylalanin Phenylalanine alpha-Amino-beta-phenylpropionic acid fenilalanina phenylalanine CHEBI:28044 phenylalanine Phenylalanine KEGG_COMPOUND DL-Phenylalanine KEGG_COMPOUND DL-Phenylalanine kegg.compound F ChEBI F chebi PHE ChEBI PHE chebi Phenylalanin ChEBI Phenylalanin chebi Phenylalanine kegg.compound alpha-Amino-beta-phenylpropionic acid KEGG_COMPOUND alpha-Amino-beta-phenylpropionic acid kegg.compound fenilalanina ChEBI fenilalanina chebi phenylalanine chebi A polydisperse highly branched polysaccharide derivative composed of chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage. The chains are joined together by alpha(1->6) glycosidic linkages. A small number of alpha(1->3) glycosidic linkages and some 6-phosphate ester groups also may occur. The branches in amylopectin typically contain 24 to 30 glucose residues. CHEBI:22538 CHEBI:2693 KEGG:C00317 Amylopectin CHEBI:28057 amylopectin Amylopectin KEGG_COMPOUND A polydisperse, highly branched glucan composed of chains of <small>D</small>-glucopyranose residues in α(1→4) glycosidic linkage, joined together by α(1→6) glycosidic linkages. A small number of α(1→3) glycosidic linkages and some cumulative α(1→6) links also may occur. The branches in glycogen typically contain 8 to 12 glucose residues. A polydisperse, highly branched glucan composed of chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage, joined together by alpha(1->6) glycosidic linkages. A small number of alpha(1->3) glycosidic linkages and some cumulative alpha(1->6) links also may occur. The branches in glycogen typically contain 8 to 12 glucose residues. CHEBI:24379 CHEBI:5466 GlyGen:G99991IU GlyTouCan:G99991IU HMDB:HMDB0000757 KEGG:C00182 MetaCyc:CPD0-971 Wikipedia:Glycogen Glycogen chebi_ontology Glycogen WURCS=2.0/1,4,3/[a2122h-1a_1-5]/1-1-1-1/a4-b1_b4-c1_b6-d1 animal starch liver starch CHEBI:28087 glycogen Glycogen KEGG_COMPOUND Glycogen kegg.compound WURCS=2.0/1,4,3/[a2122h-1a_1-5]/1-1-1-1/a4-b1_b4-c1_b6-d1 GlyTouCan animal starch ChemIDplus animal starch chemidplus liver starch ChemIDplus liver starch chemidplus A glucan composed of unbranched chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage. The number of repeated glucose subunits (n) is usually in the range of 300 to 3000, but can be many thousands. One of the two components of starch (the other, 70-80%, being amylopectin). Cf. linear maltodextrin, in which the chain length is typically between 3 and 17 glucose units. CHEBI:22539 CHEBI:2694 HMDB:HMDB0003403 KEGG:C00718 KEGG:D02329 KEGG:G10495 Wikipedia:Amylose Amylose (1,4-alpha-D-Glucosyl)n (1,4-alpha-D-Glucosyl)n+1 (1,4-alpha-D-Glucosyl)n-1 1,4-alpha-D-Glucan 4-{(1,4)-alpha-D-Glucosyl}(n-1)-D-glucose Amylose chain CHEBI:28102 amylose Amylose KEGG_COMPOUND (1,4-alpha-D-Glucosyl)n KEGG_COMPOUND (1,4-alpha-D-Glucosyl)n+1 KEGG_COMPOUND (1,4-alpha-D-Glucosyl)n-1 KEGG_COMPOUND 1,4-alpha-D-Glucan KEGG_COMPOUND 4-{(1,4)-alpha-D-Glucosyl}(n-1)-D-glucose KEGG_COMPOUND Amylose chain KEGG_COMPOUND An α-amino acid that consists of butyric acid bearing an amino substituent at position 2 and a carbamoyl substituent at position 4. CHEBI:24316 CHEBI:5432 Glutamine chebi_ontology 2,5-diamino-5-oxopentanoic acid 2-Aminoglutaramic acid 2-amino-4-carbamoylbutanoic acid Glutamin Glutamine Glutaminsaeure-5-amid Hgln glutamic acid gamma-amide CHEBI:28300 glutamine Glutamine KEGG_COMPOUND 2,5-diamino-5-oxopentanoic acid iupac 2-Aminoglutaramic acid kegg.compound 2-amino-4-carbamoylbutanoic acid jcbn Glutamin chebi Glutamine kegg.compound Glutaminsaeure-5-amid chebi Hgln iupac glutamic acid gamma-amide chebi A racemate comprising equimolar amounts of (<i>R</i>)- and (<i>S</i>)-lactic acid. CHEBI:24998 CHEBI:6351 2-Hydroxypropanoic acid chebi_ontology (+-)-2-hydroxypropanoic acid 2-Hydroxypropanoic acid 2-Hydroxypropionic acid E270 Lactic acid Milchsaeure alpha-hydroxypropanoic acid alpha-hydroxypropionic acid CHEBI:28358 rac-lactic acid 2-Hydroxypropanoic acid KEGG_COMPOUND (+-)-2-hydroxypropanoic acid chebi 2-Hydroxypropanoic acid kegg.compound 2-Hydroxypropionic acid kegg.compound E270 chebi Lactic acid kegg.compound Milchsaeure chebi alpha-hydroxypropanoic acid nist alpha-hydroxypropionic acid nist CHEBI:10197 CHEBI:13780 CHEBI:22361 chebi_ontology alpha(omega)-Dicarboxylic acid alpha,omega-Dicarboxylic acid alpha,omega-dicarboxylic acids CHEBI:28383 alpha,omega-dicarboxylic acid alpha(omega)-Dicarboxylic acid kegg.compound alpha,omega-Dicarboxylic acid kegg.compound alpha,omega-dicarboxylic acids chebi An optically active form of tyrosine having D-configuration. CHEBI:21111 CHEBI:42299 CHEBI:4258 DrugBank:DB03839 ECMDB:ECMDB21520 KEGG:C06420 MetaCyc:D-TYROSINE PDBeChem:DTY YMDB:YMDB00805 D-TYROSINE D-Tyrosine (2R)-2-amino-3-(4-hydroxyphenyl)propanoic acid (R)-2-Amino-3-(p-hydroxyphenyl)propionic acid (R)-3-(p-Hydroxyphenyl)alanine D-Tyr D-Tyrosin DTY CHEBI:28479 D-tyrosine D-TYROSINE PDBeChem D-Tyrosine KEGG_COMPOUND (2R)-2-amino-3-(4-hydroxyphenyl)propanoic acid IUPAC (R)-2-Amino-3-(p-hydroxyphenyl)propionic acid KEGG_COMPOUND (R)-3-(p-Hydroxyphenyl)alanine KEGG_COMPOUND D-Tyr ChEBI D-Tyrosin ChEBI DTY PDBeChem A one-carbon compound that is ammonia in which one of the hydrogens is replaced by a carboxy group. Although carbamic acid derivatives are common, carbamic acid itself has never been synthesised. CHEBI:22504 CHEBI:23002 CHEBI:3386 CHEBI:44573 DrugBank:DB04261 KEGG:C01563 PDBeChem:OUT Wikipedia:Carbamic_acid CARBAMIC ACID Carbamate Carbamic acid chebi_ontology Aminoameisensaeure Aminoformic acid CARBAMIC ACID Carbamate Carbamic acid Carbamidsaeure CHEBI:28616 carbamic acid CARBAMIC ACID PDBeChem Carbamate KEGG_COMPOUND Carbamic acid KEGG_COMPOUND Aminoameisensaeure ChEBI Aminoameisensaeure chebi Aminoformic acid KEGG_COMPOUND Aminoformic acid kegg.compound CARBAMIC ACID pdb-ccd Carbamate KEGG_COMPOUND Carbamate kegg.compound Carbamic acid kegg.compound Carbamidsaeure ChEBI Carbamidsaeure chebi CHEBI:26080 CHEBI:8168 KEGG:C06262 WebElements:P Phosphorus chebi_ontology 15P P Phosphor Phosphorus fosforo phosphore phosphorus CHEBI:28659 phosphorus atom Phosphorus KEGG_COMPOUND 15P IUPAC 15P iupac P IUPAC KEGG_COMPOUND P iupac kegg.compound Phosphor ChEBI Phosphor chebi Phosphorus KEGG_COMPOUND Phosphorus kegg.compound fosforo ChEBI fosforo chebi phosphore ChEBI phosphore chebi phosphorus ChEBI phosphorus chebi CHEBI:25499 CHEBI:44294 CHEBI:7511 chebi_ontology 1-(2-amino-4-hydroxy-6-pteridinyl)-1,2,3-propanetriol 2-amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone 6-(1',2',3'-trihydroxy)pterin neopterine CHEBI:28670 neopterin 1-(2-amino-4-hydroxy-6-pteridinyl)-1,2,3-propanetriol chebi 2-amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone chebi 6-(1',2',3'-trihydroxy)pterin chebi neopterine chebi CHEBI:23376 CHEBI:3874 Copper chebi_ontology 29Cu Copper Cu Kupfer cobre copper cuivre cuprum CHEBI:28694 copper atom Copper KEGG_COMPOUND 29Cu iupac Copper kegg.compound Cu chebi iupac Kupfer chebi cobre chebi copper chebi cuivre chebi cuprum iupac A primary amino compound that is the 5-hydroxy derivative of tryptamine. CHEBI:1420 CHEBI:26652 CHEBI:49894 HMDB:HMDB0000259 KEGG:C00780 KNApSAcK:C00001429 LINCS:LSM-6589 MetaCyc:SEROTONIN PDBeChem:SRO Wikipedia:Serotonin 3-(2-Aminoethyl)-1H-indol-5-ol SEROTONIN Serotonin chebi_ontology 3-(2-Aminoethyl)-1H-indol-5-ol 5-HT 5-Hydroxytryptamine Enteramine SEROTONIN Serotonin serotonine thrombocytin thrombotonin CHEBI:28790 serotonin 3-(2-Aminoethyl)-1H-indol-5-ol KEGG_COMPOUND SEROTONIN PDBeChem Serotonin KEGG_COMPOUND 3-(2-Aminoethyl)-1H-indol-5-ol KEGG_COMPOUND 3-(2-Aminoethyl)-1H-indol-5-ol kegg.compound 5-HT IUPHAR 5-HT iuphar 5-Hydroxytryptamine KEGG_COMPOUND 5-Hydroxytryptamine kegg.compound Enteramine KEGG_COMPOUND Enteramine kegg.compound SEROTONIN pdb-ccd Serotonin kegg.compound serotonine ChEBI serotonine chebi thrombocytin ChemIDplus thrombocytin chemidplus thrombotonin ChemIDplus thrombotonin chemidplus The 5α-stereoisomer of androstane. CHEBI:20638 CHEBI:2712 5alpha-Androstane Androstane chebi_ontology 5alpha-Androstane Androstane CHEBI:28859 5alpha-androstane 5alpha-Androstane KEGG_COMPOUND Androstane KEGG_COMPOUND 5alpha-Androstane kegg.compound Androstane kegg.compound The conjugate base of a fatty acid, arising from deprotonation of the carboxylic acid group of the corresponding fatty acid. CHEBI:13634 CHEBI:24022 CHEBI:4985 KEGG:C02403 Fatty acid anion chebi_ontology Alkanate Fatty acid anion Fettsaeureanion Fettsaeureanionen a fatty acid acido graso anionico acidos grasos anionicos anion de l'acide gras fatty acid anions CHEBI:28868 fatty acid anion Fatty acid anion KEGG_COMPOUND Alkanate KEGG_COMPOUND Alkanate kegg.compound Fatty acid anion kegg.compound Fettsaeureanion ChEBI Fettsaeureanion chebi Fettsaeureanionen ChEBI Fettsaeureanionen chebi a fatty acid UniProt a fatty acid uniprot_ft acido graso anionico ChEBI acido graso anionico chebi acidos grasos anionicos ChEBI acidos grasos anionicos chebi anion de l'acide gras ChEBI anion de l'acide gras chebi fatty acid anions ChEBI fatty acid anions chebi A molecule composed of a glycosphingolipid (ceramide and oligosaccharide) with one or more sialic acids linked on the sugar chain. CHEBI:26669 CHEBI:36525 CHEBI:5274 chebi_ontology ganglioside gangliosides sialoglycosphingolipid CHEBI:28892 ganglioside ganglioside chebi gangliosides chebi sialoglycosphingolipid chebi The <i>R</i>-enantiomer of adrenaline. It is a hormone secreted by the adrenal glands resulting in the 'fight-or-flight' response. The R-enantiomer of adrenaline. It is a hormone secreted by the adrenal glands resulting in the 'fight-or-flight' response. CHEBI:1942 CHEBI:23928 DrugBank:DB00668 HMDB:HMDB0000068 KEGG:C00788 KEGG:D00095 KNApSAcK:C00029643 MetaCyc:L-EPINEPHRINE Wikipedia:Epinephrine chebi_ontology (-)-(R)-epinephrine (-)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol (-)-adrenaline (R)-(-)-Adnephrine (R)-(-)-Adrenaline (R)-(-)-Epinephrine (R)-(-)-Epirenamine (R)-(-)-adrenaline 4-[(1R)-1-Hydroxy-2-(methylamino)ethyl]-1,2-benzenediol Adrenalin Epinephrin L-Adrenaline adrenaline levoepinephrine CHEBI:28918 (R)-adrenaline (-)-(R)-epinephrine ChemIDplus (-)-(R)-epinephrine chemidplus (-)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol NIST_Chemistry_WebBook (-)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol nist (-)-adrenaline IUPHAR (-)-adrenaline iuphar (R)-(-)-Adnephrine KEGG_COMPOUND (R)-(-)-Adnephrine kegg.compound (R)-(-)-Adrenaline KEGG_COMPOUND (R)-(-)-Adrenaline kegg.compound (R)-(-)-Epinephrine KEGG_COMPOUND (R)-(-)-Epinephrine kegg.compound (R)-(-)-Epirenamine KEGG_COMPOUND (R)-(-)-Epirenamine kegg.compound (R)-(-)-adrenaline ChEBI (R)-(-)-adrenaline chebi 4-[(1R)-1-Hydroxy-2-(methylamino)ethyl]-1,2-benzenediol KEGG_COMPOUND 4-[(1R)-1-Hydroxy-2-(methylamino)ethyl]-1,2-benzenediol kegg.compound Adrenalin nist Epinephrin ChEBI Epinephrin chebi L-Adrenaline KEGG_COMPOUND L-Adrenaline kegg.compound adrenaline ChEBI NIST_Chemistry_WebBook adrenaline chebi nist levoepinephrine IUPHAR levoepinephrine iuphar An onium cation obtained by protonation of ammonia. CHEBI:22534 CHEBI:49783 CHEBI:7435 KEGG:C01342 MetaCyc:AMMONIUM MolBase:929 PDBeChem:NH4 Wikipedia:Ammonium ammonium chebi_ontology Ammonium(1+) NH(4)(+) NH4(+) NH4+ [NH4](+) ammonium ammonium cation ammonium ion CHEBI:28938 ammonium ammonium ChEBI Ammonium(1+) ChemIDplus Ammonium(1+) chemidplus NH(4)(+) uniprot_ft NH4(+) IUPAC UniProt NH4(+) iupac NH4+ KEGG_COMPOUND NH4+ kegg.compound [NH4](+) MolBase [NH4](+) molbase ammonium chebi ammonium cation ChemIDplus ammonium cation chemidplus ammonium ion PDBeChem ammonium ion pdb-ccd Any sugar having one or more alcoholic hydroxy groups replaced by substituted or unsubstituted amino groups. CHEBI:22481 CHEBI:22530 CHEBI:2662 chebi_ontology Aminosugars amino sugars aminosugar CHEBI:28963 amino sugar Aminosugars kegg.compound amino sugars chebi aminosugar chebi A carboxylic acid dianion obtained by deprotonation of both carboxy groups of any dicarboxylic acid. CHEBI:13632 CHEBI:23688 CHEBI:23689 CHEBI:38711 dicarboxylic acid dianion chebi_ontology a dicarboxylate dicarboxylate dicarboxylates dicarboxylic acid dianion dicarboxylic acid dianions CHEBI:28965 dicarboxylic acid dianion dicarboxylic acid dianion ChEBI a dicarboxylate UniProt a dicarboxylate uniprot_ft dicarboxylate ChEBI dicarboxylate chebi dicarboxylates ChEBI dicarboxylates chebi dicarboxylic acid dianion chebi dicarboxylic acid dianions ChEBI dicarboxylic acid dianions chebi CHEBI:13351 CHEBI:23017 CHEBI:23744 CHEBI:3401 KEGG:C01353 PDBeChem:CO3 Carbonic acid chebi_ontology Carbonic acid Dihydrogen carbonate H2CO3 Koehlensaeure [CO(OH)2] CHEBI:28976 carbonic acid Carbonic acid KEGG_COMPOUND Carbonic acid kegg.compound Dihydrogen carbonate KEGG_COMPOUND Dihydrogen carbonate kegg.compound H2CO3 IUPAC KEGG_COMPOUND H2CO3 iupac kegg.compound Koehlensaeure ChEBI Koehlensaeure chebi [CO(OH)2] IUPAC [CO(OH)2] iupac An α-amino acid that is glycine in which the α-is substituted by a 3-guanidinopropyl group. CHEBI:22616 CHEBI:2643 Arginine chebi_ontology 2-Amino-5-guanidinovaleric acid 2-amino-5-(carbamimidamido)pentanoic acid 2-amino-5-guanidinopentanoic acid Arginin Arginine Harg CHEBI:29016 arginine Arginine KEGG_COMPOUND 2-Amino-5-guanidinovaleric acid kegg.compound 2-amino-5-(carbamimidamido)pentanoic acid iupac 2-amino-5-guanidinopentanoic acid jcbn Arginin chebi Arginine kegg.compound Harg iupac CHEBI:14490 CHEBI:24954 CHEBI:29057 keratan The conjugate base formed when the carboxy group of a carboxylic acid is deprotonated. CHEBI:13626 CHEBI:13945 CHEBI:23026 CHEBI:58657 chebi_ontology a carboxylate carboxylic acid anions carboxylic anions CHEBI:29067 carboxylic acid anion a carboxylate UniProt a carboxylate uniprot_ft carboxylic acid anions ChEBI carboxylic acid anions chebi carboxylic anions ChEBI carboxylic anions chebi The <small>L</small>-enantiomer of ascorbic acid and conjugate acid of <small>L</small>-ascorbate. CHEBI:17208 CHEBI:21240 CHEBI:2868 CHEBI:40892 CHEBI:43473 chebi_ontology ASCORBIC ACID Ascorbic acid Ascorbicap Ascorbinsaeure E 300 E-300 E300 L-(+)-ascorbic acid L-Ascorbate L-Ascorbic acid Vitamin C acidum ascorbinicum CHEBI:29073 L-ascorbic acid ASCORBIC ACID pdb-ccd Ascorbic acid kegg.compound Ascorbicap kegg.drug Ascorbinsaeure chebi E 300 chebi E-300 chebi E300 chebi L-(+)-ascorbic acid nist L-Ascorbate kegg.compound L-Ascorbic acid kegg.compound Vitamin C kegg.compound acidum ascorbinicum chemidplus CHEBI:14616 CHEBI:25404 CHEBI:6983 KEGG:C02171 Mononucleotide chebi_ontology Mononucleotide mononucleotides CHEBI:29075 mononucleotide Mononucleotide KEGG_COMPOUND Mononucleotide kegg.compound mononucleotides ChEBI mononucleotides chebi A monoatomic monocation obtained from sodium. CHEBI:26717 CHEBI:49766 CHEBI:9175 KEGG:C01330 PDBeChem:NA chebi_ontology Na(+) Na+ SODIUM ION CHEBI:29101 sodium(1+) Na(+) IUPAC UniProt Na(+) iupac uniprot_ft Na+ KEGG_COMPOUND Na+ kegg.compound SODIUM ION PDBeChem SODIUM ION pdb-ccd A monoatomic monocation obtained from potassium. CHEBI:26219 CHEBI:49685 CHEBI:8345 KEGG:C00238 KEGG:D08403 PDBeChem:K K(+) K+ POTASSIUM ION CHEBI:29103 potassium(1+) K(+) IUPAC UniProt K+ KEGG_COMPOUND POTASSIUM ION PDBeChem CHEBI:22988 CHEBI:3308 CHEBI:48760 KEGG:C00076 PDBeChem:CA CALCIUM ION Ca(2+) Ca2+ calcium, doubly charged positive ion CHEBI:29108 calcium(2+) CALCIUM ION PDBeChem Ca(2+) IUPAC UniProt Ca2+ KEGG_COMPOUND calcium, doubly charged positive ion NIST_Chemistry_WebBook chebi_ontology HO2(-) HOO anion HOO(-) [HO2](-) hydrogenperoxide(1-) CHEBI:29192 hydrogenperoxide(1-) HO2(-) iupac HOO anion nist HOO(-) chebi [HO2](-) chebi hydrogenperoxide(1-) iupac chebi_ontology HSHO3 Sulfonsaeure [SHO2(OH)] acide sulfonique sulphonic acid CHEBI:29214 sulfonic acid HSHO3 iupac Sulfonsaeure chebi [SHO2(OH)] iupac acide sulfonique chebi sulphonic acid chebi An organosulfur compound in which a thiol group, ‒SH, is attached to a carbon atom of any aliphatic or aromatic moiety. CHEBI:13443 CHEBI:13696 CHEBI:17366 CHEBI:26969 CHEBI:8766 CHEBI:9556 Thiol thiols chebi_ontology Mercaptan Merkaptan RSH Thiol a thiol mercaptans thiols CHEBI:29256 thiol Thiol KEGG_COMPOUND thiols ChEBI Mercaptan kegg.compound Merkaptan chebi RSH iupac Thiol kegg.compound a thiol uniprot_ft mercaptans chebi thiols chebi chebi_ontology NH2(-) CHEBI:29337 azanide NH2(-) IUPAC NH2(-) iupac A divalent inorganic anion resulting from the removal of two protons from ammonia. chebi_ontology NH(2-) imide CHEBI:29340 hydridonitrate(2-) NH(2-) IUPAC NH(2-) iupac imide IUPAC imide iupac A carboxamide derived from a monocarboxylic acid. CHEBI:13211 CHEBI:22207 CHEBI:25383 CHEBI:6977 chebi_ontology monocarboxylic acid amides CHEBI:29347 monocarboxylic acid amide monocarboxylic acid amides chebi A monocarboxylic acid amide derived from a fatty acid. CHEBI:13247 CHEBI:22310 CHEBI:22330 CHEBI:2572 CHEBI:35749 CHEBI:38838 chebi_ontology Aliphatic amide fatty amide fatty amides CHEBI:29348 fatty amide Aliphatic amide kegg.compound fatty amide chebi fatty amides lipidmaps chebi_ontology CH2(2-) [CH2](2-) CHEBI:29360 methanediide CH2(2-) iupac [CH2](2-) chebi chebi_ontology -OO- CHEBI:29369 peroxy group -OO- iupac MolBase:1646 chebi_ontology H3O(+) Hydronium cation Hydronium ion [OH3](+) CHEBI:29412 oxonium H3O(+) IUPAC H3O(+) iupac Hydronium cation NIST_Chemistry_WebBook Hydronium cation nist Hydronium ion ChemIDplus Hydronium ion chemidplus [OH3](+) MolBase [OH3](+) molbase chebi_ontology #CH CHEBI:29429 methylidyne group #CH iupac chebi_ontology CH3(-) [CH3](-) lambda(2)-methanuide methyl anion CHEBI:29438 methanide CH3(-) iupac [CH3](-) chebi lambda(2)-methanuide iupac methyl anion iupac The organophosphate oxoanion formed from choline by removal of two protons from the phosphate group. Major species at pH 7.3. chebi_ontology 2-(trimethylammonio)ethyl phosphate phosphocholine CHEBI:295975 choline phosphate(1-) 2-(trimethylammonio)ethyl phosphate iupac phosphocholine uniprot_ft chebi_ontology -OOH CHEBI:29792 hydroperoxy group -OOH iupac HO2(+) HOO(+) [HO2](+) CHEBI:29793 hydridodioxygen(1+) HO2(+) IUPAC HOO(+) ChEBI [HO2](+) ChEBI CHEBI:26821 CHEBI:29916 chebi_ontology -SH HS- Mercaptogruppe Merkaptogruppe Sulfhydrylgruppe Thiolgruppe mercapto group sulfhydryl group sulphydryl group thiol group CHEBI:29917 thiol group -SH iupac HS- iupac Mercaptogruppe chebi Merkaptogruppe chebi Sulfhydrylgruppe chebi Thiolgruppe chebi mercapto group chebi sulfhydryl group chebi sulphydryl group chebi thiol group uniprot_ft chebi_ontology HS anion HS(-) hydrogen sulfide hydrosulfide CHEBI:29919 hydrosulfide HS anion nist HS(-) iupac hydrogen sulfide uniprot_ft hydrosulfide iupac chebi_ontology -S(O)2(OH) SULFO GROUP CHEBI:29922 sulfo group -S(O)2(OH) iupac SULFO GROUP pdb-ccd A prephenate(2-) obtained by deprotonation of both carboxy groups of (1s,4s)-prephenic acid; major species at pH 7.3. CHEBI:14884 CHEBI:26256 KEGG:C00254 MetaCyc:PREPHENATE cis-prephenate prephenate CHEBI:29934 (1s,4s)-prephenate(2-) cis-prephenate ChEBI prephenate UniProt D-tyrosine residue D-Tyr D-tyrosine acid residue D-tyrosyl DTyr CHEBI:29976 D-tyrosine residue D-tyrosine residue JCBN D-Tyr JCBN D-tyrosine acid residue JCBN D-tyrosyl ChEBI DTyr JCBN An alpha-amino-acid anion that is the conjugate base of L-glutamic acid, having anionic carboxy groups and a cationic amino group An α-amino-acid anion that is the conjugate base of <small>L</small>-glutamic acid, having anionic carboxy groups and a cationic amino group CHEBI:13107 CHEBI:21301 MetaCyc:GLT L-glutamate L-glutamate(1-) chebi_ontology (2S)-2-ammoniopentanedioate L-glutamate L-glutamate(1-) L-glutamic acid monoanion L-glutamic acid, ion(1-) CHEBI:29985 L-glutamate(1-) L-glutamate ChEBI L-glutamate(1-) JCBN (2S)-2-ammoniopentanedioate IUPAC (2S)-2-ammoniopentanedioate iupac L-glutamate ChEBI UniProt L-glutamate chebi uniprot_ft L-glutamate(1-) jcbn L-glutamic acid monoanion JCBN L-glutamic acid monoanion jcbn L-glutamic acid, ion(1-) ChemIDplus L-glutamic acid, ion(1-) chemidplus An alpha-amino-acid anion that is the conjugate base of D-glutamic acid, having anionic carboxy groups and a cationic amino group An α-amino-acid anion that is the conjugate base of <small>D</small>-glutamic acid, having anionic carboxy groups and a cationic amino group CHEBI:12979 CHEBI:21022 MetaCyc:D-GLT D-glutamate(1-) chebi_ontology (2R)-2-ammoniopentanedioate D-glutamate D-glutamate(1-) D-glutamic acid monoanion CHEBI:29986 D-glutamate(1-) D-glutamate(1-) JCBN (2R)-2-ammoniopentanedioate IUPAC (2R)-2-ammoniopentanedioate iupac D-glutamate UniProt D-glutamate uniprot_ft D-glutamate(1-) jcbn D-glutamic acid monoanion JCBN D-glutamic acid monoanion jcbn A dicarboxylic acid dianion that is the conjugate base of glutamate(1-). A dicarboxylic acid dianion that is the conjugate base of glutamate(1−). glutamate(2-) chebi_ontology glutamate(2-) glutamic acid dianion CHEBI:29987 glutamate(2-) glutamate(2-) JCBN glutamate(2-) jcbn glutamic acid dianion JCBN glutamic acid dianion jcbn An <small>L</small>-α-amino acid anion that is the dianion obtained by the deprotonation of the both the carboxy groups of <small>L</small>-glutamic acid. An L-alpha-amino acid anion that is the dianion obtained by the deprotonation of the both the carboxy groups of L-glutamic acid. L-glutamate(2-) chebi_ontology L-glutamate(2-) L-glutamic acid dianion CHEBI:29988 L-glutamate(2-) L-glutamate(2-) JCBN L-glutamate(2-) jcbn L-glutamic acid dianion JCBN L-glutamic acid dianion jcbn D-glutamate(2-) chebi_ontology D-glutamate(2-) D-glutamic acid dianion CHEBI:29989 D-glutamate(2-) D-glutamate(2-) JCBN D-glutamate(2-) jcbn D-glutamic acid dianion JCBN D-glutamic acid dianion jcbn An aspartate(1−) that is the conjugate base of <small>D</small>-aspartic acid. CHEBI:12918 CHEBI:20919 chebi_ontology (2R)-2-ammoniobutanedioate (2R)-2-ammoniosuccinate D-aspartate D-aspartate(1-) D-aspartic acid monoanion CHEBI:29990 D-aspartate(1-) (2R)-2-ammoniobutanedioate iupac (2R)-2-ammoniosuccinate chebi D-aspartate uniprot_ft D-aspartate(1-) jcbn D-aspartic acid monoanion jcbn An aspartate(1−) that is the conjugate base of <small>L</small>-aspartic acid. CHEBI:13085 CHEBI:21244 L-aspartate chebi_ontology (2S)-2-ammoniobutanedioate (2S)-2-ammoniosuccinate L-aspartate L-aspartate(1-) L-aspartic acid monoanion CHEBI:29991 L-aspartate(1-) L-aspartate ChEBI (2S)-2-ammoniobutanedioate iupac (2S)-2-ammoniosuccinate chebi L-aspartate chebi uniprot_ft L-aspartate(1-) jcbn L-aspartic acid monoanion jcbn An aspartate(2−) that is the conjugate base of <small>L</small>-aspartate(1−). chebi_ontology (2S)-2-aminosuccinate L-aspartate(2-) L-aspartic acid dianion CHEBI:29993 L-aspartate(2-) (2S)-2-aminosuccinate chebi L-aspartate(2-) jcbn L-aspartic acid dianion jcbn An aspartate(2−) that is the conjugate base of <small>D</small>-aspartate(1−). chebi_ontology (2R)-2-aminosuccinate D-aspartate(2-) D-aspartic acid dianion CHEBI:29994 D-aspartate(2-) (2R)-2-aminosuccinate chebi D-aspartate(2-) jcbn D-aspartic acid dianion jcbn A C4-dicarboxylate that is the dianion obtained by the deprotonation of both the carboxy groups of aspartic acid. chebi_ontology 2-aminosuccinate aspartate(2-) aspartic acid dianion CHEBI:29995 aspartate(2-) 2-aminosuccinate chebi aspartate(2-) jcbn aspartic acid dianion jcbn chebi_ontology Cu(0) Cun copper(0) CHEBI:30052 copper(0) Cu(0) chebi Cun iupac copper(0) iupac A monocarboxylic acid anion resulting from the removal of a proton from the carboxy group of acetic acid. CHEBI:13704 CHEBI:22165 CHEBI:40480 DrugBank:DB03166 KEGG:C00033 MetaCyc:ACET PDBeChem:ACT Wikipedia:Acetate chebi_ontology ACETATE ION Azetat CH3-COO(-) Ethanoat MeCO2 anion acetate acetic acid, ion(1-) ethanoate CHEBI:30089 acetate ACETATE ION PDBeChem ACETATE ION pdb-ccd Azetat ChEBI Azetat chebi CH3-COO(-) IUPAC CH3-COO(-) iupac Ethanoat ChEBI Ethanoat chebi MeCO2 anion NIST_Chemistry_WebBook MeCO2 anion nist acetate uniprot_ft acetic acid, ion(1-) ChemIDplus acetic acid, ion(1-) chemidplus ethanoate ChEBI ethanoate chebi Particle of zero charge, zero rest mass, spin quantum number 1, energy hnu and momentum hnu/c (h is the Planck constant, nu the frequency of radiation and c the speed of light), carrier of electromagnetic force. CHEBI:10581 CHEBI:14383 KEGG:C00205 Lichtquant Light foton gamma hnu light quantum CHEBI:30212 photon Lichtquant ChEBI Light KEGG_COMPOUND foton ChEBI gamma IUPAC hnu IUPAC UniProt light quantum ChEBI chebi_ontology (CH3)2CH- -CH(CH3)2 1-methylethyl iPr valine side-chain CHEBI:30353 isopropyl group (CH3)2CH- iupac -CH(CH3)2 chebi 1-methylethyl iupac iPr iubmb valine side-chain chebi chebi_ontology (CH3)2CH-CH2- -CH2-CH(CH3)2 iBu leucine side-chain CHEBI:30356 isobutyl group (CH3)2CH-CH2- iupac -CH2-CH(CH3)2 chebi iBu iubmb leucine side-chain chebi An alkane that is propane substituted by a methyl group at position 2. chebi_ontology (CH3)2CH-CH3 E943b R-600a CHEBI:30363 isobutane (CH3)2CH-CH3 iupac E943b chebi R-600a chebi CHEBI:23856 CHEBI:4665 KEGG:C00572 Divalent cation divalent inorganic cations monoatomic dications CHEBI:30412 monoatomic dication Divalent cation KEGG_COMPOUND divalent inorganic cations ChEBI monoatomic dications ChEBI A heme is any tetrapyrrolic chelate of iron. CHEBI:14386 CHEBI:24491 heme chebi_ontology Haem haem haeme hem heme hemos CHEBI:30413 heme heme UniProt Haem chebi haem chebi iupac haeme iupac hem iupac heme iupac uniprot_ft hemos iupac chebi_ontology H3S(+) H3S+ [SH3](+) sulphonium CHEBI:30488 sulfonium H3S(+) iupac H3S+ nist [SH3](+) chebi sulphonium chebi An gamma-amino acid anion resulting from the deprotonation of the carboxy group of gamma-aminobutyric acid. An γ-amino acid anion resulting from the deprotonation of the carboxy group of γ-aminobutyric acid. CHEBI:11961 CHEBI:20317 KEGG:C00334 chebi_ontology 4-Amino-butyrat 4-Aminobutylate 4-aminobutanoic acid ion (1-) 4-aminobutyrate gamma-aminobutanoate gamma-aminobutyrate anion CHEBI:30566 gamma-aminobutyrate 4-Amino-butyrat ChEBI 4-Amino-butyrat chebi 4-Aminobutylate KEGG_COMPOUND 4-Aminobutylate kegg.compound 4-aminobutanoic acid ion (1-) ChEBI 4-aminobutanoic acid ion (1-) chebi 4-aminobutyrate ChEBI 4-aminobutyrate chebi gamma-aminobutanoate ChEBI gamma-aminobutanoate chebi gamma-aminobutyrate anion ChEBI gamma-aminobutyrate anion chebi The amino acid zwitterion formed from thyroxine by transfer of a proton from the carboxy group to the amino group. Major species at pH 7.3. chebi_ontology 2-Amino-3-[4-(4-hydroxy-3,5-diiodo-phenoxy)-3,5-diiodo-phenyl]-propionate thyroxine CHEBI:305790 thyroxine zwitterion 2-Amino-3-[4-(4-hydroxy-3,5-diiodo-phenoxy)-3,5-diiodo-phenyl]-propionate chembl thyroxine uniprot_ft A nucleoside triphosphate(4-) obtained by global deprotonation of the triphosphate OH groups of ATP; major species present at pH 7.3. A nucleoside triphosphate(4−) obtained by global deprotonation of the triphosphate OH groups of ATP; major species present at pH 7.3. chebi_ontology ATP atp CHEBI:30616 ATP(4-) ATP UniProt ATP uniprot_ft atp IUPAC atp iupac A dicarboxylic acid dianion obtained by deprotonation of both carboxy groups of oxalic acid. CHEBI:14702 CHEBI:25729 CHEBI:44820 chebi_ontology OXALATE ION ethanedioic acid, ion(2-) ox oxalate CHEBI:30623 oxalate(2-) OXALATE ION pdb-ccd ethanedioic acid, ion(2-) chemidplus ox iupac oxalate uniprot_ft An iodothyronine compound having iodo substituents at the 3-, 3'-, 5- and 5'-positions. chebi_ontology 2-amino-3-[4-(4-hydroxy-3,5-diiodophenoxy)-3,5-diiodophenyl]propanoic acid DL-Thyroxine O-(4-Hydroxy-3,5-diiodophenyl)-3,5-diiodo-DL-tyrosine Thx CHEBI:30660 thyroxine 2-amino-3-[4-(4-hydroxy-3,5-diiodophenoxy)-3,5-diiodophenyl]propanoic acid iupac DL-Thyroxine chemidplus O-(4-Hydroxy-3,5-diiodophenyl)-3,5-diiodo-DL-tyrosine chemidplus Thx iupac A tyrosine derivative where the phenolic hydrogen of tyrosine is substituted by 4-hydroxyphenyl. chebi_ontology 2-amino-3-[4-(4-hydroxyphenoxy)phenyl]propanoic acid O-(4-hydroxyphenyl)-DL-tyrosine CHEBI:30661 thyronine 2-amino-3-[4-(4-hydroxyphenoxy)phenyl]propanoic acid iupac O-(4-hydroxyphenyl)-DL-tyrosine chemidplus The simplest carboxylic acid, containing a single carbon. Occurs naturally in various sources including the venom of bee and ant stings, and is a useful organic synthetic reagent. Principally used as a preservative and antibacterial agent in livestock feed. Induces severe metabolic acidosis and ocular injury in human subjects. CHEBI:24082 CHEBI:42460 CHEBI:5145 BPDB:1749 DrugBank:DB01942 HMDB:HMDB0000142 KEGG:C00058 KNApSAcK:C00001182 MetaCyc:FORMATE PDBeChem:FMT Patent:CN101481304 Wikipedia:Formic_acid FORMIC ACID Formic acid chebi_ontology Acide formique Ameisensaeure FORMIC ACID Formic acid H-COOH HCO2H HCOOH Methanoic acid aminic acid bilorin formylic acid hydrogen carboxylic acid methoic acid CHEBI:30751 formic acid FORMIC ACID PDBeChem Formic acid KEGG_COMPOUND Acide formique ChemIDplus Acide formique chemidplus Ameisensaeure ChemIDplus Ameisensaeure chemidplus FORMIC ACID pdb-ccd Formic acid kegg.compound H-COOH IUPAC H-COOH iupac HCO2H ChEBI HCO2H chebi HCOOH NIST_Chemistry_WebBook HCOOH nist Methanoic acid KEGG_COMPOUND Methanoic acid kegg.compound aminic acid ChemIDplus aminic acid chemidplus bilorin ChemIDplus bilorin chemidplus formylic acid ChemIDplus formylic acid chemidplus hydrogen carboxylic acid ChemIDplus hydrogen carboxylic acid chemidplus methoic acid ChEBI methoic acid chebi A short-chain saturated fatty acid comprising ethane attached to the carbon of a carboxy group. CHEBI:26304 CHEBI:45227 CHEBI:8476 DrugBank:DB03766 KEGG:C00163 KEGG:D02310 PDBeChem:PPI PPDB:1341 PROPANOIC ACID Propanoic acid Propionic acid propionic acid chebi_ontology CH3-CH2-COOH PA PROPANOIC ACID Propanoic acid Propionic acid Propionsaeure acide propanoique acide propionique carboxyethane ethanecarboxylic acid ethylformic acid metacetonic acid methylacetic acid propioic acid propionic acid propoic acid pseudoacetic acid CHEBI:30768 propionic acid PROPANOIC ACID PDBeChem Propanoic acid KEGG_COMPOUND Propionic acid KEGG_COMPOUND propionic acid IUPAC CH3-CH2-COOH IUPAC CH3-CH2-COOH iupac PA ChEBI PA chebi PROPANOIC ACID PDBeChem PROPANOIC ACID pdb-ccd Propanoic acid KEGG_COMPOUND Propanoic acid kegg.compound Propionic acid kegg.compound Propionsaeure ChEBI Propionsaeure chebi acide propanoique ChEBI acide propanoique chebi acide propionique NIST_Chemistry_WebBook acide propionique nist carboxyethane ChemIDplus carboxyethane chemidplus ethanecarboxylic acid ChemIDplus ethanecarboxylic acid chemidplus ethylformic acid ChemIDplus ethylformic acid chemidplus metacetonic acid ChemIDplus metacetonic acid chemidplus methylacetic acid ChemIDplus methylacetic acid chemidplus propioic acid LIPID_MAPS propioic acid lipidmaps propionic acid iupac propoic acid ChEBI propoic acid chebi pseudoacetic acid ChemIDplus pseudoacetic acid chemidplus A tricarboxylic acid that is propane-1,2,3-tricarboxylic acid bearing a hydroxy substituent at position 2. It is an important metabolite in the pathway of all aerobic organisms. CHEBI:23322 CHEBI:3727 CHEBI:41523 chebi_ontology 2-Hydroxy-1,2,3-propanetricarboxylic acid 2-Hydroxytricarballylic acid 3-Carboxy-3-hydroxypentane-1,5-dioic acid CITRIC ACID Citric acid Citronensaeure E330 H3cit CHEBI:30769 citric acid 2-Hydroxy-1,2,3-propanetricarboxylic acid kegg.compound 2-Hydroxytricarballylic acid kegg.compound 3-Carboxy-3-hydroxypentane-1,5-dioic acid hmdb CITRIC ACID pdb-ccd Citric acid kegg.compound Citronensaeure chebi E330 chebi H3cit iupac A straight-chain saturated fatty acid that is butane in which one of the terminal methyl groups has been oxidised to a carboxy group. CHEBI:113450 CHEBI:22948 CHEBI:3234 CHEBI:41208 DrugBank:DB03568 HMDB:HMDB0000039 KEGG:C00246 KNApSAcK:C00001180 MetaCyc:BUTYRIC_ACID PDBeChem:BUA Wikipedia:Butyric_acid BUTANOIC ACID Butanoic acid Butyric acid butyric acid chebi_ontology 1-butanoic acid 1-butyric acid 1-propanecarboxylic acid 4:0 BUTANOIC ACID Butanoate Butanoic acid Buttersaeure Butyric acid C4:0 CH3-[CH2]2-COOH acide butanoique acide butyrique butanic acid butoic acid butyric acid ethylacetic acid n-butanoic acid n-butyric acid propanecarboxylic acid propylformic acid CHEBI:30772 butyric acid BUTANOIC ACID PDBeChem Butanoic acid KEGG_COMPOUND Butyric acid KEGG_COMPOUND butyric acid IUPAC 1-butanoic acid HMDB 1-butanoic acid hmdb 1-butyric acid HMDB 1-butyric acid hmdb 1-propanecarboxylic acid MetaCyc 1-propanecarboxylic acid metacyc.compound 4:0 ChEBI 4:0 chebi BUTANOIC ACID PDBeChem BUTANOIC ACID pdb-ccd Butanoate KEGG_COMPOUND Butanoate kegg.compound Butanoic acid KEGG_COMPOUND Butanoic acid kegg.compound Buttersaeure ChEBI Buttersaeure chebi Butyric acid kegg.compound C4:0 ChEBI C4:0 chebi CH3-[CH2]2-COOH IUPAC CH3-[CH2]2-COOH iupac acide butanoique IUPAC acide butanoique iupac acide butyrique ChEBI acide butyrique chebi butanic acid ChEBI butanic acid chebi butoic acid ChEBI butoic acid chebi butyric acid iupac ethylacetic acid NIST_Chemistry_WebBook ethylacetic acid nist n-butanoic acid NIST_Chemistry_WebBook n-butanoic acid nist n-butyric acid NIST_Chemistry_WebBook n-butyric acid nist propanecarboxylic acid HMDB propanecarboxylic acid hmdb propylformic acid MetaCyc propylformic acid metacyc.compound A C<small>₆</small>, straight-chain saturated fatty acid. CHEBI:24571 CHEBI:40213 CHEBI:5702 HEXANOIC ACID Hexanoic acid chebi_ontology 1-hexanoic acid 1-pentanecarboxylic acid 6:0 C6:0 CH3-[CH2]4-COOH HEXANOIC ACID Hexanoate Hexanoic acid Hexylic acid Pentanecarboxylic acid butylacetic acid caproic acid capronic acid hexoic acid n-Caproic acid n-hexanoic acid n-hexoic acid n-hexylic acid pentiformic acid pentylformic acid CHEBI:30776 hexanoic acid HEXANOIC ACID PDBeChem Hexanoic acid KEGG_COMPOUND 1-hexanoic acid chemidplus 1-pentanecarboxylic acid chemidplus 6:0 chebi C6:0 chebi CH3-[CH2]4-COOH iupac HEXANOIC ACID pdb-ccd Hexanoate kegg.compound Hexanoic acid kegg.compound Hexylic acid kegg.compound Pentanecarboxylic acid chemidplus butylacetic acid chemidplus caproic acid chebi capronic acid nist hexoic acid nist n-Caproic acid kegg.compound n-hexanoic acid nist n-hexoic acid chemidplus n-hexylic acid chemidplus pentiformic acid chemidplus pentylformic acid chemidplus An α,ω-dicarboxylic acid in which the two carboxy groups are separated by a single methylene group. CHEBI:25132 CHEBI:44060 CHEBI:6660 Propanedioic acid chebi_ontology H2malo HOOC-CH2-COOH MALONIC ACID Malonic acid Propanedioic acid CHEBI:30794 malonic acid Propanedioic acid KEGG_COMPOUND H2malo iupac HOOC-CH2-COOH iupac MALONIC ACID pdb-ccd Malonic acid kegg.compound Propanedioic acid kegg.compound chebi_ontology HOOC-CH2-COO(-) Hmalo Malonic acid, conjugate base CHEBI:30795 malonate(1-) HOOC-CH2-COO(-) chebi Hmalo iupac Malonic acid, conjugate base nist CHEBI:14698 CHEBI:25719 chebi_ontology orotate CHEBI:30839 orotate orotate uniprot_ft CHEBI:15290 chebi_ontology 7,9-dihydro-1H-purine-2,6,8(3H)-trione, ion(1-) uric acid monoanion uric acid, ion(1-) CHEBI:30848 urate(1-) 7,9-dihydro-1H-purine-2,6,8(3H)-trione, ion(1-) chemidplus uric acid monoanion chebi uric acid, ion(1-) chemidplus A dicarboxylic acid that is malonic acid in which one of the methylene hydrogens is substituted by a methyl group. CHEBI:25319 CHEBI:42270 CHEBI:6881 chebi_ontology 1,1-Ethanedicarboxylic acid 2-methylmalonic acid Isosuccinic acid METHYLMALONIC ACID Methylmalonic acid alpha-methylmalonic acid CHEBI:30860 methylmalonic acid 1,1-Ethanedicarboxylic acid hmdb 2-methylmalonic acid nist Isosuccinic acid hmdb METHYLMALONIC ACID pdb-ccd Methylmalonic acid kegg.compound alpha-methylmalonic acid chebi A dicarboxylic acid monoanion resulting from the removal of a proton from one of the carboxylic acid groups of methylmalonic acid. chebi_ontology CHEBI:30861 methylmalonate(1-) A compound in which a hydroxy group, -OH, is attached to a saturated carbon atom. A compound in which a hydroxy group, ‒OH, is attached to a saturated carbon atom. CHEBI:13804 CHEBI:22288 CHEBI:2553 KEGG:C00069 Alcohol chebi_ontology Alcohol an alcohol CHEBI:30879 alcohol Alcohol KEGG_COMPOUND Alcohol kegg.compound an alcohol UniProt an alcohol uniprot_ft A dicarboxylic acid dianion obtained by deprotonation of both the carboxy groups of glutaric acid. CHEBI:14322 CHEBI:24327 chebi_ontology glutarate CHEBI:30921 glutarate(2-) glutarate uniprot_ft Any member of a group of hydroxy-5beta-cholanic acids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration. KEGG:C01558 Bile acid 5beta-bile acid 5beta-bile acids Bile salt Gallensaeure Gallensaeuren bile acids CHEBI:3098 bile acid Bile acid KEGG_COMPOUND 5beta-bile acid ChEBI 5beta-bile acids ChEBI Bile salt KEGG_COMPOUND Gallensaeure ChEBI Gallensaeuren ChEBI bile acids ChEBI A short-chain fatty acid anion that is the conjugate base of valeric acid; present in ester form as component of many steroid-based pharmaceuticals. CHEBI:14751 CHEBI:25890 chebi_ontology CH3-[CH2]3-COO(-) n-propylacetate pentanoate pentanoic acid, ion(1-) CHEBI:31011 valerate CH3-[CH2]3-COO(-) iupac n-propylacetate chebi pentanoate uniprot_ft pentanoic acid, ion(1-) chemidplus A linear nonapeptide messenger belonging to the kinin group of proteins, with amino acid sequence RPPGFSPFR. Enzymatically produced from kallidin in the blood, it is a powerful vasodilator that causes smooth muscle contraction, and may mediate inflammation. chebi_ontology Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg BK L-Arg-L-Pro-L-Pro-Gly-L-Phe-L-Ser-L-Pro-L-Phe-L-Arg L-bradykinin RPPGFSPFR CHEBI:3165 bradykinin Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg chebi BK chemidplus L-Arg-L-Pro-L-Pro-Gly-L-Phe-L-Ser-L-Pro-L-Phe-L-Arg chebi L-bradykinin chebi RPPGFSPFR chebi A long-chain fatty acid anion resulting from the removal of a proton from the carboxy group of arachidonic acid. CHEBI:13852 CHEBI:22607 chebi_ontology (20:4n6) (5Z,8Z,11Z,14Z)-eicosatetraenoate 5Z,8Z,11Z,14Z-eicosatetraenoate CHEBI:32395 arachidonate (20:4n6) chebi (5Z,8Z,11Z,14Z)-eicosatetraenoate uniprot_ft 5Z,8Z,11Z,14Z-eicosatetraenoate chebi An α-amino-acid anion that is the conjugate base of alanine, arising from deprotonation of the carboxy group. chebi_ontology alaninate alanine anion CHEBI:32439 alaninate alaninate jcbn alanine anion jcbn An α-amino-acid cation that is the conjugate acid of alanine. chebi_ontology alanine cation alaninium CHEBI:32440 alaninium alanine cation jcbn alaninium jcbn The <small>L</small>-enantiomer of cysteinate(1−). chebi_ontology (2R)-2-amino-3-mercaptopropanoate (2R)-2-amino-3-sulfanylpropanoate L-cysteinate(1-) L-cysteine anion L-cysteine monoanion CHEBI:32442 L-cysteinate(1-) (2R)-2-amino-3-mercaptopropanoate chebi (2R)-2-amino-3-sulfanylpropanoate iupac L-cysteinate(1-) jcbn L-cysteine anion nist L-cysteine monoanion jcbn The <small>L</small>-enantiomer of cysteinate(2−). chebi_ontology (2R)-2-amino-3-sulfidopropanoate L-cysteinate(2-) L-cysteine dianion CHEBI:32443 L-cysteinate(2-) (2R)-2-amino-3-sulfidopropanoate iupac L-cysteinate(2-) jcbn L-cysteine dianion jcbn The <small>L</small>-enantiomer of cysteinium. chebi_ontology (1R)-1-carboxy-2-mercaptoethanaminium (1R)-1-carboxy-2-sulfanylethanaminium L-cysteine cation L-cysteinium(1+) CHEBI:32445 L-cysteinium (1R)-1-carboxy-2-mercaptoethanaminium chebi (1R)-1-carboxy-2-sulfanylethanaminium iupac L-cysteine cation jcbn L-cysteinium(1+) chebi The <small>D</small>-enantiomer of cysteinate(1−). chebi_ontology (2S)-2-amino-3-mercaptopropanoate (2S)-2-amino-3-sulfanylpropanoate D-cysteinate(1-) D-cysteine monoanion CHEBI:32449 D-cysteinate(1-) (2S)-2-amino-3-mercaptopropanoate chebi (2S)-2-amino-3-sulfanylpropanoate iupac D-cysteinate(1-) jcbn D-cysteine monoanion jcbn The <small>D</small>-enantiomer of cysteinate(2−). chebi_ontology (2S)-2-amino-3-sulfidopropanoate D-cysteinate(2-) D-cysteine dianion CHEBI:32450 D-cysteinate(2-) (2S)-2-amino-3-sulfidopropanoate iupac D-cysteinate(2-) jcbn D-cysteine dianion jcbn The <small>D</small>-enantiomer of cysteinium. chebi_ontology (1S)-1-carboxy-2-mercaptoethanaminium (1S)-1-carboxy-2-sulfanylethanaminium D-cysteine cation CHEBI:32451 D-cysteinium (1S)-1-carboxy-2-mercaptoethanaminium chebi (1S)-1-carboxy-2-sulfanylethanaminium iupac D-cysteine cation jcbn A sulfur-containing amino-acid anion that is the conjugate base of cysteine, obtained by deprotonation of the carboxy group. chebi_ontology 2-amino-3-mercaptopropanoate 2-amino-3-sulfanylpropanoate cys(-) cysteinate(1-) cysteine monoanion CHEBI:32456 cysteinate(1-) 2-amino-3-mercaptopropanoate chebi 2-amino-3-sulfanylpropanoate iupac cys(-) iupac cysteinate(1-) jcbn cysteine monoanion jcbn chebi_ontology 2-amino-3-sulfidopropanoate cysteinate(2-) cysteine dianion CHEBI:32457 cysteinate(2-) 2-amino-3-sulfidopropanoate iupac cysteinate(2-) jcbn cysteine dianion jcbn chebi_ontology 1-carboxy-2-mercaptoethanaminium H2cys(+) cysteine cation cysteinium CHEBI:32458 cysteinium 1-carboxy-2-mercaptoethanaminium chebi H2cys(+) iupac cysteine cation jcbn cysteinium jcbn An optically active form of phenylalaninate having L-configuration. (2S)-2-amino-3-phenylpropanoate L-phenylalanine anion CHEBI:32486 L-phenylalaninate (2S)-2-amino-3-phenylpropanoate IUPAC L-phenylalanine anion JCBN An optically active form of phenylalaninium having L-configuration. (1S)-1-carboxy-2-phenylethanaminium L-phenylalanine cation CHEBI:32487 L-phenylalaninium (1S)-1-carboxy-2-phenylethanaminium IUPAC L-phenylalanine cation JCBN The D-enantiomer of phenylalaninate. (2R)-2-amino-3-phenylpropanoate D-phenylalanine anion CHEBI:32494 D-phenylalaninate (2R)-2-amino-3-phenylpropanoate IUPAC D-phenylalanine anion JCBN An optically active form of phenylalaninium having D-configuration. (1R)-1-carboxy-2-phenylethanaminium D-phenylalanine cation CHEBI:32495 D-phenylalaninium (1R)-1-carboxy-2-phenylethanaminium IUPAC D-phenylalanine cation JCBN An aromatic amino-acid anion that is the conjugate base of phenylalanine, arising from deprotonation of the carboxy group. chebi_ontology 2-amino-3-phenylpropanoate phenylalanine anion CHEBI:32504 phenylalaninate 2-amino-3-phenylpropanoate IUPAC 2-amino-3-phenylpropanoate iupac phenylalanine anion JCBN phenylalanine anion jcbn An alpha-amino-acid cation that is the conjugate acid of phenylalanine, arising from protonation of the amino group. An α-amino-acid cation that is the conjugate acid of phenylalanine, arising from protonation of the amino group. chebi_ontology 1-carboxy-2-phenylethanaminium phenylalanine cation CHEBI:32505 phenylalaninium 1-carboxy-2-phenylethanaminium IUPAC 1-carboxy-2-phenylethanaminium iupac phenylalanine cation JCBN phenylalanine cation jcbn An α-amino-acid cation that is the conjugate acid of glycine, arising from protonation of the amino. chebi_ontology H2gly(+) NH3(+)-CH2-COOH carboxymethanaminium glycine cation CHEBI:32507 glycinium H2gly(+) iupac NH3(+)-CH2-COOH iupac carboxymethanaminium iupac glycine cation jcbn An α-amino-acid anion that is the conjugate base of glycine, arising from deprotonation of the carboxy group. chebi_ontology H2N-CH2-COO(-) aminoacetate gly(-) glycine anion CHEBI:32508 glycinate H2N-CH2-COO(-) iupac aminoacetate iupac gly(-) iupac glycine anion jcbn chebi_ontology 2-amino-3-(1H-imidazol-4-yl)propanoate histidinate(1-) histidine anion CHEBI:32529 histidinate(1-) 2-amino-3-(1H-imidazol-4-yl)propanoate iupac histidinate(1-) jcbn histidine anion jcbn chebi_ontology 2-amino-3-imidazol-1-id-4-ylpropanoate histidinate(2-) histidine dianion CHEBI:32530 histidinate(2-) 2-amino-3-imidazol-1-id-4-ylpropanoate iupac histidinate(2-) jcbn histidine dianion jcbn chebi_ontology 2-ammonio-3-(1H-imidazol-3-ium-4-yl)propanoate histidine monocation histidinium(1+) CHEBI:32531 histidinium(1+) 2-ammonio-3-(1H-imidazol-3-ium-4-yl)propanoate iupac histidine monocation jcbn histidinium(1+) jcbn chebi_ontology 4-(2-ammonio-2-carboxyethyl)-1H-imidazol-3-ium histidine dication histidinium(2+) CHEBI:32532 histidinium(2+) 4-(2-ammonio-2-carboxyethyl)-1H-imidazol-3-ium iupac histidine dication jcbn histidinium(2+) jcbn An α-amino-acid anion that is the conjugate base of lysine, arising from deprotonation of the carboxy group. chebi_ontology 2,6-diaminohexanoate lys(-) lysinate(1-) lysine anion CHEBI:32563 lysinate 2,6-diaminohexanoate iupac lys(-) iupac lysinate(1-) chebi lysine anion jcbn An α-amino-acid cation that is the conjugate acid of lysine, having two cationic amino groups and an anionic carboxy group. chebi_ontology 2,6-diammoniohexanoate lysine monocation lysinium(1+) CHEBI:32564 lysinium(1+) 2,6-diammoniohexanoate iupac lysine monocation jcbn lysinium(1+) jcbn An α-amino-acid cation obtained by protonation of both amino groups of lysine. chebi_ontology 1-carboxypentane-1,5-diaminium lysine dication lysinium(2+) CHEBI:32565 lysinium(2+) 1-carboxypentane-1,5-diaminium iupac lysine dication jcbn lysinium(2+) jcbn chebi_ontology ile(-) isoleucine anion rel-(2R,3R)-2-amino-3-methylpentanoate CHEBI:32612 isoleucinate ile(-) iupac isoleucine anion jcbn rel-(2R,3R)-2-amino-3-methylpentanoate iupac chebi_ontology H2ile(+) isoleucine cation rel-(1R,2R)-1-carboxy-2-methylbutan-1-aminium CHEBI:32613 isoleucinium H2ile(+) iupac isoleucine cation jcbn rel-(1R,2R)-1-carboxy-2-methylbutan-1-aminium iupac An α-amino-acid anion that is the conjugate base of leucine, arising from deprotonation of the carboxy group. chebi_ontology 2-amino-4-methylpentanoate leu(-) leucine anion CHEBI:32627 leucinate 2-amino-4-methylpentanoate iupac leu(-) iupac leucine anion jcbn An α-amino-acid cation that is the conjugate acid of leucine, arising from protonation of the amino group. chebi_ontology 1-carboxy-3-methylbutan-1-aminium H2leu(+) leucine cation CHEBI:32628 leucinium 1-carboxy-3-methylbutan-1-aminium iupac H2leu(+) iupac leucine cation jcbn A sulfur-containing amino-acid anion that is the conjugate base of methionine, arising from deprotonation of the carboxy group. chebi_ontology 2-amino-4-(methylsulfanyl)butanoate met(-) methionine anion CHEBI:32644 methioninate 2-amino-4-(methylsulfanyl)butanoate iupac met(-) iupac methionine anion jcbn A sulfur-containing amino-acid cation that is the conjugate acid of methionine, arising from protonation of the amino group. chebi_ontology 1-carboxy-3-(methylsulfanyl)propan-1-aminium H2met(+) methionine cation CHEBI:32646 methioninium 1-carboxy-3-(methylsulfanyl)propan-1-aminium iupac H2met(+) iupac methionine cation jcbn An α-amino-acid anion that is the conjugate base of glutamine, arising from deprotonation of the carboxy group. chebi_ontology 2,5-diamino-5-oxopentanoate gln(-) glutamine anion CHEBI:32678 glutaminate 2,5-diamino-5-oxopentanoate iupac gln(-) iupac glutamine anion jcbn An α-amino-acid cation that is the conjugate acid of glutamine, arising from protonation of the amino group. chebi_ontology 4-amino-1-carboxy-4-oxobutan-1-aminium H2gln(+) glutamine cation CHEBI:32679 glutaminium 4-amino-1-carboxy-4-oxobutan-1-aminium iupac H2gln(+) iupac glutamine cation jcbn chebi_ontology 2-amino-5-(carbamimidamido)pentanoate 2-amino-5-guanidinopentanoate arg(-) arginine anion CHEBI:32695 argininate 2-amino-5-(carbamimidamido)pentanoate iupac 2-amino-5-guanidinopentanoate jcbn arg(-) iupac arginine anion jcbn chebi_ontology 2-ammonio-5-guanidiniopentanoate H2arg(+) arginine arginine monocation argininium(1+) CHEBI:32696 argininium(1+) 2-ammonio-5-guanidiniopentanoate jcbn H2arg(+) iupac arginine uniprot_ft arginine monocation jcbn argininium(1+) jcbn chebi_ontology (1-carboxy-4-guanidiniobutyl)ammonium H3arg(2+) arginine dication argininium(2+) CHEBI:32697 argininium(2+) (1-carboxy-4-guanidiniobutyl)ammonium chebi H3arg(2+) iupac arginine dication jcbn argininium(2+) jcbn An α-amino-acid anion that is the conjugate base of tryptophan, arising from deprotonation of the carboxy group. chebi_ontology 2-amino-3-(1H-indol-3-yl)propanoate trp(-) tryptophan anion CHEBI:32727 tryptophanate 2-amino-3-(1H-indol-3-yl)propanoate iupac trp(-) iupac tryptophan anion jcbn An α-amino-acid cation that is the conjugate acid of tryptophan, arising from protonation of the α-amino group. chebi_ontology 1-carboxy-2-(1H-indol-3-yl)ethanaminium Htrp(+) tryptophan cation CHEBI:32728 tryptophanium 1-carboxy-2-(1H-indol-3-yl)ethanaminium iupac Htrp(+) iupac tryptophan cation jcbn An optically active form of tyrosinate having L-configuration. L-tyrosinate(1-) (2S)-2-amino-3-(4-hydroxyphenyl)propanoate L-tyrosine anion L-tyrosine monoanion CHEBI:32760 L-tyrosinate(1-) L-tyrosinate(1-) JCBN (2S)-2-amino-3-(4-hydroxyphenyl)propanoate IUPAC L-tyrosine anion NIST_Chemistry_WebBook L-tyrosine monoanion JCBN The L-enantiomer of tyrosinate(2-). L-tyrosinate(2-) (2S)-2-amino-3-(4-oxidophenyl)propanoate L-tyrosine dianion CHEBI:32761 L-tyrosinate(2-) L-tyrosinate(2-) JCBN (2S)-2-amino-3-(4-oxidophenyl)propanoate IUPAC L-tyrosine dianion JCBN An optically active form of tyrosinium having L-configuration. (1S)-1-carboxy-2-(4-hydroxyphenyl)ethanaminium L-tyrosine cation CHEBI:32762 L-tyrosinium (1S)-1-carboxy-2-(4-hydroxyphenyl)ethanaminium IUPAC L-tyrosine cation JCBN An optically active form of tyrosinate(1-) having D-configuration. D-tyrosinate(1-) (2R)-2-amino-3-(4-hydroxyphenyl)propanoate D-tyrosine monoanion CHEBI:32773 D-tyrosinate(1-) D-tyrosinate(1-) JCBN (2R)-2-amino-3-(4-hydroxyphenyl)propanoate IUPAC D-tyrosine monoanion JCBN The D-enantiomer of tyrosinate(2-). D-tyrosinate(2-) (2R)-2-amino-3-(4-oxidophenyl)propanoate D-tyrosine dianion CHEBI:32774 D-tyrosinate(2-) D-tyrosinate(2-) JCBN (2R)-2-amino-3-(4-oxidophenyl)propanoate IUPAC D-tyrosine dianion JCBN An optically active form of tyrosinium having D-configuration. (1R)-1-carboxy-2-(4-hydroxyphenyl)ethanaminium D-tyrosine cation CHEBI:32775 D-tyrosinium (1R)-1-carboxy-2-(4-hydroxyphenyl)ethanaminium IUPAC D-tyrosine cation JCBN An alpha-amino-acid anion that is the conjugate base of tyrosine, arising from deprotonation of the carboxy group. An α-amino-acid anion that is the conjugate base of tyrosine, arising from deprotonation of the carboxy group. tyrosinate(1-) chebi_ontology 2-amino-3-(4-hydroxyphenyl)propanoate tyrosinate(1-) tyrosine anion CHEBI:32784 tyrosinate(1-) tyrosinate(1-) JCBN 2-amino-3-(4-hydroxyphenyl)propanoate IUPAC 2-amino-3-(4-hydroxyphenyl)propanoate iupac tyrosinate(1-) jcbn tyrosine anion JCBN tyrosine anion jcbn tyrosinate(2-) chebi_ontology 2-amino-3-(4-oxidophenyl)propanoate tyrosinate(2-) tyrosine dianion CHEBI:32785 tyrosinate(2-) tyrosinate(2-) JCBN 2-amino-3-(4-oxidophenyl)propanoate IUPAC 2-amino-3-(4-oxidophenyl)propanoate iupac tyrosinate(2-) jcbn tyrosine dianion JCBN tyrosine dianion jcbn An alpha-amino-acid cation that is the conjugate acid of tyrosine, arising from protonation of the amino group. An α-amino-acid cation that is the conjugate acid of tyrosine, arising from protonation of the amino group. chebi_ontology 1-carboxy-2-(4-hydroxyphenyl)ethanaminium tyrosine cation CHEBI:32786 tyrosinium 1-carboxy-2-(4-hydroxyphenyl)ethanaminium IUPAC 1-carboxy-2-(4-hydroxyphenyl)ethanaminium iupac tyrosine cation JCBN tyrosine cation jcbn tyrosine residue tyrosine acid residue tyrosyl CHEBI:32789 tyrosine residue tyrosine residue JCBN tyrosine acid residue JCBN tyrosyl ChEBI chebi_ontology rel-(2R,3S)-2-amino-3-hydroxybutanoate threonine anion CHEBI:32832 threoninate rel-(2R,3S)-2-amino-3-hydroxybutanoate iupac threonine anion jcbn chebi_ontology rel-(1R,2S)-1-carboxy-2-hydroxypropan-1-aminium threonine cation CHEBI:32833 threoninium rel-(1R,2S)-1-carboxy-2-hydroxypropan-1-aminium iupac threonine cation jcbn An α-amino-acid anion that is the conjugate base of serine. chebi_ontology 2-amino-3-hydroxypropanoate serine anion CHEBI:32845 serinate 2-amino-3-hydroxypropanoate iupac serine anion jcbn An α-amino-acid cation that is the conjugate acid of serine. chebi_ontology 1-carboxy-2-hydroxyethanaminium serine cation CHEBI:32846 serinium 1-carboxy-2-hydroxyethanaminium iupac serine cation jcbn chebi_ontology 2-amino-3-methylbutanoate val(-) valine anion CHEBI:32859 valinate 2-amino-3-methylbutanoate iupac val(-) iupac valine anion jcbn chebi_ontology 1-carboxy-2-methylpropan-1-aminium H2val(+) valine cation CHEBI:32860 valinium 1-carboxy-2-methylpropan-1-aminium iupac H2val(+) iupac valine cation jcbn An α-amino-acid anion that is the conjugate base of proline, arising from deprotonation of the carboxy group. chebi_ontology pro(-) proline anion pyrrolidine-2-carboxylate CHEBI:32871 prolinate pro(-) iupac proline anion jcbn pyrrolidine-2-carboxylate iupac An α-amino-acid cation that is the conjugate acid of proline, arising from protonation of the amino group. chebi_ontology 2-carboxypyrrolidinium H2pro(+) proline cation CHEBI:32872 prolinium 2-carboxypyrrolidinium iupac H2pro(+) iupac proline cation jcbn A compound formally derived from ammonia by replacing three hydrogen atoms by hydrocarbyl groups. CHEBI:26879 CHEBI:9458 chebi_ontology R3N Tertiary amine tertiaeres Amin CHEBI:32876 tertiary amine R3N iupac Tertiary amine kegg.compound tertiaeres Amin chebi A compound formally derived from ammonia by replacing one hydrogen atom by a hydrocarbyl group. CHEBI:26263 CHEBI:26265 CHEBI:8407 CHEBI:8409 chebi_ontology Primary amine Primary monoamine R-NH2 RCH2NH2 primaeres Amin CHEBI:32877 primary amine Primary amine kegg.compound Primary monoamine kegg.compound R-NH2 iupac RCH2NH2 kegg.compound primaeres Amin chebi chebi_ontology CH3-CH2-CH3 E944 Propan propane CHEBI:32879 propane CH3-CH2-CH3 iupac E944 chebi Propan chebi propane uniprot_ft A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups. CHEBI:13814 CHEBI:22474 CHEBI:2641 KEGG:C00706 Amine chebi_ontology Amin Amine Substituted amine CHEBI:32952 amine Amine KEGG_COMPOUND Amin ChEBI Amin chebi Amine kegg.compound Substituted amine KEGG_COMPOUND Substituted amine kegg.compound CHEBI:11448 CHEBI:19370 chebi_ontology ornithine anion CHEBI:32964 ornithinate ornithine anion jcbn A 1,1-diunsubstituted alkanesulfonate that is ethanesulfonate substituted by an amino group at position 2. chebi_ontology CHEBI:32970 2-aminoethanesulfonate An amide is a derivative of an oxoacid R<small>_<em>k</em></small>E(=O)<small>_<em>l</em></small>(OH)<small>_<em>m</em></small> (<em>l</em> ≠ 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. An amide is a derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. CHEBI:22473 CHEBI:2633 KEGG:C00241 Amide chebi_ontology Amide CHEBI:32988 amide Amide KEGG_COMPOUND Amide kegg.compound A 32-membered heterodetic cyclic peptide comprising the sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 cyclised by a disulfide bridge between the two Cys residues at positions 1 and 7. DrugBank:DB00017 KEGG:C06865 KEGG:D00249 Wikipedia:Calcitonin Calcitonin Calcitonin, salmon Cibacalcin Salmon calcitonin Salmon calcitonin-(1-32) Salmotonin Thyrocalcitonin (salmon) cyclo-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 CHEBI:3306 calcitonin Calcitonin KEGG_COMPOUND Calcitonin, salmon KEGG_COMPOUND Cibacalcin KEGG_COMPOUND Salmon calcitonin ChemIDplus Salmon calcitonin-(1-32) ChemIDplus Salmotonin DrugBank Thyrocalcitonin (salmon) ChemIDplus cyclo-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 ChEBI A calcium salt with formula CCaO3. BPDB:108 DrugBank:DB06724 KEGG:C08129 KEGG:D00932 PPDB:108 Wikipedia:Calcium_carbonate Calcium carbonate CaCO3 Calciumcarbonat E 170 Kalziumkarbonat Precipitated calcium carbonate calcium carbonate (1:1) carbonate de calcium carbonato de calcio carbonic acid calcium salt (1:1) kohlensaurer Kalk CHEBI:3311 calcium carbonate Calcium carbonate KEGG_COMPOUND CaCO3 IUPAC Calciumcarbonat ChEBI E 170 ChEBI Kalziumkarbonat ChEBI Precipitated calcium carbonate KEGG_COMPOUND calcium carbonate (1:1) ChemIDplus carbonate de calcium ChEBI carbonato de calcio ChEBI carbonic acid calcium salt (1:1) ChemIDplus kohlensaurer Kalk ChEBI A benzopyran consisting of a pyran ring having a benzene ring <em>ortho</em>-fused across positions 2 and 3. chebi_ontology 3,4-dihydro-2H-1-benzopyran 3,4-dihydrobenzo[b]pyran Chroman chromane CHEBI:33224 chromane 3,4-dihydro-2H-1-benzopyran nist 3,4-dihydrobenzo[b]pyran chebi Chroman nist chromane iupac A biochemical role played by any micronutrient that is an organic compound. Vitamins are present in foods in small amounts and are essential to normal metabolism and biochemical functions, usually as coenzymes. The term "vitamines" (from <em>vita</em> + amines) was coined in 1912 by Casimir Funk, who believed that these compounds were amines. CHEBI:10004 CHEBI:27305 chebi_ontology vitamin vitamina vitaminas vitamine vitamines vitamins vitaminum CHEBI:33229 vitamin (role) vitamin chebi vitamina chebi vitaminas chebi vitamine chebi vitamines chebi vitamins chebi vitaminum chebi Intended use of the molecular entity or part thereof by humans. chebi_ontology CHEBI:33232 application A particle not known to have substructure. chebi_ontology elementary particles CHEBI:33233 fundamental particle elementary particles ChEBI elementary particles chebi Any member of a group of fat-soluble chromanols that exhibit biological activity against vitamin E deficiency. The vitamers in this class consists of a chroman-6-ol core which is substituted at position 2 by a methyl group and (also at position 2) either a saturated or a triply-unsaturated hydrocarbon chain consisting of three isoprenoid units. The major function of vitamin E is to act as a natural antioxidant by scavenging free radicals and molecular oxygen. chebi_ontology vitamin E vitamin E vitamer vitamin E vitamers vitamin-E vitamins E CHEBI:33234 vitamin E vitamin E chemidplus vitamin E vitamer chebi vitamin E vitamers chebi vitamin-E chebi vitamins E chebi A monoatomic entity is a molecular entity consisting of a single atom. chebi_ontology atomic entity monoatomic entities CHEBI:33238 monoatomic entity atomic entity ChEBI atomic entity chebi monoatomic entities ChEBI monoatomic entities chebi An assembly consisting of a central atom (usually metallic) to which is attached a surrounding array of other groups of atoms (ligands). chebi_ontology coordination compounds CHEBI:33240 coordination entity coordination compounds chebi chebi_ontology oxoacid derivatives CHEBI:33241 oxoacid derivative oxoacid derivatives ChEBI oxoacid derivatives chebi chebi_ontology inorganic hydrides CHEBI:33242 inorganic hydride inorganic hydrides ChEBI inorganic hydrides chebi An organic fundamental parent is a structure used as a basis for substitutive names in organic nomenclature, containing, in addition to one or more hydrogen atoms, a single atom of an element, a number of atoms (alike or different) linked together to form an unbranched chain, a monocyclic or polycyclic ring system, or a ring assembly or ring/chain system. chebi_ontology organic fundamental parents organic parent hydrides CHEBI:33245 organic fundamental parent organic fundamental parents ChEBI organic fundamental parents chebi organic parent hydrides ChEBI organic parent hydrides chebi Any substituent group which does not contain carbon. chebi_ontology inorganic groups CHEBI:33246 inorganic group inorganic groups ChEBI inorganic groups chebi Any substituent group or skeleton containing carbon. chebi_ontology organic groups CHEBI:33247 organic group organic groups ChEBI organic groups chebi A univalent group formed by removing a hydrogen atom from a hydrocarbon. chebi_ontology groupe hydrocarbyle grupo hidrocarbilo grupos hidrocarbilo hydrocarbyl group CHEBI:33248 hydrocarbyl group groupe hydrocarbyle iupac grupo hidrocarbilo iupac grupos hidrocarbilo iupac hydrocarbyl group iupac Any organic substituent group, regardless of functional type, having one free valence at a carbon atom. chebi_ontology groupe organyle grupo organilo grupos organilo CHEBI:33249 organyl group groupe organyle IUPAC groupe organyle iupac grupo organilo IUPAC grupo organilo iupac grupos organilo IUPAC grupos organilo iupac A chemical entity constituting the smallest component of an element having the chemical properties of the element. CHEBI:22671 CHEBI:23907 chebi_ontology atome atomo atoms atomus element elements CHEBI:33250 atom atome IUPAC atome iupac atomo IUPAC atomo iupac atoms ChEBI atoms chebi atomus ChEBI atomus chebi element ChEBI element chebi elements ChEBI elements chebi atomic hydrogen CHEBI:33251 monoatomic hydrogen atomic hydrogen ChEBI A nucleus is the positively charged central portion of an atom, excluding the orbital electrons. chebi_ontology Atomkern Kern noyau noyau atomique nuclei nucleo nucleo atomico nucleus atomi CHEBI:33252 atomic nucleus Atomkern ChEBI Atomkern chebi Kern ChEBI Kern chebi noyau IUPAC noyau iupac noyau atomique ChEBI noyau atomique chebi nuclei ChEBI nuclei chebi nucleo IUPAC nucleo iupac nucleo atomico ChEBI nucleo atomico chebi nucleus atomi ChEBI nucleus atomi chebi Heavy nuclear particle: proton or neutron. chebi_ontology Nukleon Nukleonen nucleon nucleons CHEBI:33253 nucleon Nukleon ChEBI Nukleon chebi Nukleonen ChEBI Nukleonen chebi nucleon iupac nucleons ChEBI nucleons chebi A derivative of an oxoacid R<small>_<em>k</em></small>E(=O)<small>_<em>l</em></small>(OH)<small>_<em>m</em></small> (<em>l</em> ≠ 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. A derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. primary amide chebi_ontology primary amide CHEBI:33256 primary amide primary amide IUPAC primary amide iupac A molecular entity all atoms of which have the same atomic number. chebi_ontology homoatomic entity homoatomic molecular entities homoatomic molecular entity CHEBI:33259 elemental molecular entity homoatomic entity ChEBI homoatomic entity chebi homoatomic molecular entities ChEBI homoatomic molecular entities chebi homoatomic molecular entity ChEBI homoatomic molecular entity chebi CHEBI:33260 elemental hydrogen An organosulfur compound is a compound containing at least one carbon-sulfur bond. CHEBI:23010 CHEBI:25714 chebi_ontology organosulfur compound organosulfur compounds CHEBI:33261 organosulfur compound organosulfur compound chebi organosulfur compounds chebi CHEBI:33262 elemental oxygen CHEBI:33263 diatomic oxygen An anion consisting of more than one atom. chebi_ontology polyatomic anions CHEBI:33273 polyatomic anion polyatomic anions ChEBI polyatomic anions chebi chebi_ontology chemical messenger CHEBI:33280 molecular messenger chemical messenger ChEBI chemical messenger chebi A substance that kills or slows the growth of microorganisms, including bacteria, viruses, fungi and protozoans. CHEBI:22582 chebi_ontology Antibiotika Antibiotikum antibiotic antibiotics antibiotique antimicrobial antimicrobial agents antimicrobials microbicide microbicides CHEBI:33281 antimicrobial agent Antibiotika ChEBI Antibiotika chebi Antibiotikum ChEBI Antibiotikum chebi antibiotic ChEBI antibiotic chebi antibiotics ChEBI antibiotics chebi antibiotique IUPAC antibiotique iupac antimicrobial ChEBI antimicrobial chebi antimicrobial agents ChEBI antimicrobial agents chebi antimicrobials ChEBI antimicrobials chebi microbicide ChEBI microbicide chebi microbicides ChEBI microbicides chebi A substance (or active part thereof) that kills or slows the growth of bacteria. chebi_ontology antibacterial agents antibacterials bactericide bactericides CHEBI:33282 antibacterial agent antibacterial agents ChEBI antibacterial agents chebi antibacterials ChEBI antibacterials chebi bactericide ChEBI bactericide chebi bactericides ChEBI bactericides chebi A nutrient is a food component that an organism uses to survive and grow. chebi_ontology nutrients CHEBI:33284 nutrient nutrients ChEBI nutrients chebi A heteroorganic entity is an organic molecular entity in which carbon atoms or organic groups are bonded directly to one or more heteroatoms. chebi_ontology heteroorganic entities organoelement compounds CHEBI:33285 heteroorganic entity heteroorganic entities ChEBI heteroorganic entities chebi organoelement compounds ChEBI organoelement compounds chebi An agrochemical is a substance that is used in agriculture or horticulture. Wikipedia:Agrochemical chebi_ontology agrichemical agrichemicals agricultural chemicals agrochemicals CHEBI:33286 agrochemical agrichemical ChEBI agrichemical chebi agrichemicals ChEBI agrichemicals chebi agricultural chemicals ChEBI agricultural chemicals chebi agrochemicals ChEBI agrochemicals chebi A fertilizer is any substance that is added to soil or water to assist the growth of plants. chebi_ontology fertiliser fertilizers CHEBI:33287 fertilizer fertiliser ChEBI fertiliser chebi fertilizers ChEBI fertilizers chebi A physiological role played by any substance of either plant, animal or artificial origin which contains essential body nutrients that can be ingested by an organism to provide energy, promote growth, and maintain the processes of life. food material food materials food role foods foodstuff foodstuffs CHEBI:33290 food food material ChEBI food materials ChEBI food role ChEBI foods ChEBI foodstuff ChEBI foodstuffs ChEBI An energy-rich substance that can be transformed with release of usable energy. chebi_ontology CHEBI:33292 fuel A substance administered to aid diagnosis of a disease. chebi_ontology diagnostic aid CHEBI:33295 diagnostic agent diagnostic aid ChEBI diagnostic aid chebi A molecular entity containing one or more atoms of an alkali metal. chebi_ontology alkali metal molecular entities CHEBI:33296 alkali metal molecular entity alkali metal molecular entities ChEBI alkali metal molecular entities chebi An alkaline earth molecular entity is a molecular entity containing one or more atoms of an alkaline earth metal. alkaline earth molecular entity alkaline earth compounds alkaline earth molecular entities alkaline-earth compounds CHEBI:33299 alkaline earth molecular entity alkaline earth molecular entity ChEBI alkaline earth compounds ChEBI alkaline earth molecular entities ChEBI alkaline-earth compounds ChEBI Any p-block element atom that is in group 15 of the periodic table: nitrogen, phosphorus, arsenic, antimony and bismuth. chebi_ontology group 15 elements group V elements nitrogenoideos nitrogenoides pnictogene pnictogenes CHEBI:33300 pnictogen group 15 elements ChEBI group 15 elements chebi group V elements ChEBI group V elements chebi nitrogenoideos ChEBI nitrogenoideos chebi nitrogenoides ChEBI nitrogenoides chebi pnictogene ChEBI pnictogene chebi pnictogenes ChEBI pnictogenes chebi A p-block molecular entity containing any pnictogen. pnictogen molecular entity chebi_ontology pnictogen molecular entities pnictogen molecular entity CHEBI:33302 pnictogen molecular entity pnictogen molecular entity ChEBI pnictogen molecular entities ChEBI pnictogen molecular entities chebi pnictogen molecular entity chebi Any p-block element belonging to the group 16 family of the periodic table. chebi_ontology Chalkogen Chalkogene anfigeno anfigenos calcogeno calcogenos chalcogene chalcogenes group 16 elements group VI elements CHEBI:33303 chalcogen Chalkogen ChEBI Chalkogen chebi Chalkogene ChEBI Chalkogene chebi anfigeno ChEBI anfigeno chebi anfigenos ChEBI anfigenos chebi calcogeno ChEBI calcogeno chebi calcogenos ChEBI calcogenos chebi chalcogene ChEBI chalcogene chebi chalcogenes ChEBI chalcogenes chebi group 16 elements ChEBI group 16 elements chebi group VI elements ChEBI group VI elements chebi Any p-block molecular entity containing a chalcogen. chalcogen molecular entity chebi_ontology chalcogen compounds chalcogen molecular entities chalcogen molecular entity CHEBI:33304 chalcogen molecular entity chalcogen molecular entity ChEBI chalcogen compounds ChEBI chalcogen compounds chebi chalcogen molecular entities ChEBI chalcogen molecular entities chebi chalcogen molecular entity chebi chebi_ontology carbon group element carbon group elements carbonoides cristallogene cristallogenes group IV elements CHEBI:33306 carbon group element atom carbon group element ChEBI carbon group element chebi carbon group elements ChEBI carbon group elements chebi carbonoides ChEBI carbonoides chebi cristallogene ChEBI cristallogene chebi cristallogenes ChEBI cristallogenes chebi group IV elements ChEBI group IV elements chebi An ester of a carboxylic acid, R(1)C(=O)OR(2), where R(1) = H or organyl and R(2) = organyl. An ester of a carboxylic acid, R<small>^1</small>C(=O)OR<small>^2</small>, where R<small>^1</small> = H or organyl and R<small>^2</small> = organyl. CHEBI:13204 CHEBI:23028 CHEBI:3408 KEGG:C02391 Wikipedia:Ester Carboxylic ester chebi_ontology Carboxylic ester a carboxylic ester carboxylic acid esters CHEBI:33308 carboxylic ester Carboxylic ester KEGG_COMPOUND Carboxylic ester kegg.compound a carboxylic ester UniProt a carboxylic ester uniprot_ft carboxylic acid esters ChEBI carboxylic acid esters chebi An atom belonging to one of the main groups (found in the s- and p- blocks) of the periodic table. chebi_ontology Hauptgruppenelement Hauptgruppenelemente main group element CHEBI:33318 main group element atom Hauptgruppenelement ChEBI Hauptgruppenelement chebi Hauptgruppenelemente ChEBI Hauptgruppenelemente chebi main group element ChEBI main group element chebi chebi_ontology zinc group element zinc group elements CHEBI:33340 zinc group element atom zinc group element chebi zinc group elements chebi chebi_ontology iron group element iron group elements CHEBI:33356 iron group element atom iron group element ChEBI iron group element chebi iron group elements ChEBI iron group elements chebi chebi_ontology coinage metals copper group element copper group elements CHEBI:33366 copper group element atom coinage metals chebi copper group element chebi copper group elements chebi chebi_ontology oxoacids of sulfur sulfur oxoacids CHEBI:33402 sulfur oxoacid oxoacids of sulfur ChEBI oxoacids of sulfur chebi sulfur oxoacids ChEBI sulfur oxoacids chebi A hydracid is a compound which contains hydrogen that is not bound to oxygen, and which produces a conjugate base by loss of positive hydrogen ion(s) (hydrons). chebi_ontology hydracids CHEBI:33405 hydracid hydracids chebi chebi_ontology pnictogen oxoacids CHEBI:33408 pnictogen oxoacid pnictogen oxoacids ChEBI pnictogen oxoacids chebi sulfur oxoacid derivative chebi_ontology sulfur oxoacid derivative sulfur oxoacid derivatives CHEBI:33424 sulfur oxoacid derivative sulfur oxoacid derivative ChEBI sulfur oxoacid derivative chebi sulfur oxoacid derivatives ChEBI sulfur oxoacid derivatives chebi chebi_ontology monoatomic monoanions CHEBI:33429 monoatomic monoanion monoatomic monoanions chebi chebi_ontology CHEBI:33431 elemental chlorine chebi_ontology atomic chlorine CHEBI:33432 monoatomic chlorine atomic chlorine chebi chebi_ontology monoatomic halogens CHEBI:33433 monoatomic halogen monoatomic halogens chebi chebi_ontology elemental halogen elemental halogens CHEBI:33434 elemental halogen elemental halogen chebi elemental halogens chebi Any monosaccharide containing an alcoholic hydroxy group esterified with phosphoric acid. CHEBI:15132 CHEBI:16442 CHEBI:25406 CHEBI:26086 CHEBI:9320 KEGG:C00934 phospho sugar chebi_ontology monosaccharide phosphates phospho sugar phospho sugars phosphorylated sugar phosphorylated sugars phosphosugar phosphosugars CHEBI:33447 phospho sugar phospho sugar ChEBI monosaccharide phosphates ChEBI monosaccharide phosphates chebi phospho sugar chebi phospho sugars ChEBI phospho sugars chebi phosphorylated sugar ChEBI phosphorylated sugar chebi phosphorylated sugars ChEBI phosphorylated sugars chebi phosphosugar ChEBI phosphosugar chebi phosphosugars ChEBI phosphosugars chebi Arylmethyl groups and derivatives formed by substitution: ArCR2-. Arylmethyl groups and derivatives formed by substitution: ArCR<small>₂</small>‒. benzylic group chebi_ontology benzylic group benzylic groups groupe benzylique CHEBI:33452 benzylic group benzylic group IUPAC benzylic group iupac benzylic groups ChEBI benzylic groups chebi groupe benzylique IUPAC groupe benzylique iupac chebi_ontology nitrogen oxoacids oxoacids of nitrogen CHEBI:33455 nitrogen oxoacid nitrogen oxoacids chebi oxoacids of nitrogen chebi A pnictogen oxoacid which contains phosphorus and oxygen, at least one hydrogen atom bound to oxygen, and forms an ion by the loss of one or more protons. phosphorus oxoacid chebi_ontology Oxosaeure des Phosphors oxoacids of phosphorus phosphorus oxoacid phosphorus oxoacids CHEBI:33457 phosphorus oxoacid phosphorus oxoacid ChEBI Oxosaeure des Phosphors ChEBI Oxosaeure des Phosphors chebi oxoacids of phosphorus ChEBI oxoacids of phosphorus chebi phosphorus oxoacid chebi phosphorus oxoacids ChEBI phosphorus oxoacids chebi chebi_ontology nitrogen oxoanion nitrogen oxoanions oxoanions of nitrogen CHEBI:33458 nitrogen oxoanion nitrogen oxoanion chebi nitrogen oxoanions chebi oxoanions of nitrogen chebi pnictogen oxoanion chebi_ontology pnictogen oxoanion pnictogen oxoanions CHEBI:33459 pnictogen oxoanion pnictogen oxoanion ChEBI pnictogen oxoanion chebi pnictogen oxoanions ChEBI pnictogen oxoanions chebi phosphorus oxoanion chebi_ontology oxoanions of phosphorus phosphorus oxoanion phosphorus oxoanions CHEBI:33461 phosphorus oxoanion phosphorus oxoanion ChEBI oxoanions of phosphorus ChEBI oxoanions of phosphorus chebi phosphorus oxoanion chebi phosphorus oxoanions ChEBI phosphorus oxoanions chebi Trivalent groups, RC≡, formed by removing three hydrogen atoms from the same carbon atom of a hydrocarbon, the free valencies of which are engaged in a triple bond. chebi_ontology RC# groupe hydrocarbylidyne hydrocarbylidyne group hydrocarbylidyne groups CHEBI:33474 hydrocarbylidyne group RC# iupac groupe hydrocarbylidyne iupac hydrocarbylidyne group iupac hydrocarbylidyne groups chebi sulfur oxoanion chebi_ontology oxoanions of sulfur sulfur oxoanion sulfur oxoanions CHEBI:33482 sulfur oxoanion sulfur oxoanion ChEBI oxoanions of sulfur ChEBI oxoanions of sulfur chebi sulfur oxoanion chebi sulfur oxoanions ChEBI sulfur oxoanions chebi chalcogen oxoacid chebi_ontology chalcogen oxoacid chalcogen oxoacids CHEBI:33484 chalcogen oxoacid chalcogen oxoacid ChEBI chalcogen oxoacid chebi chalcogen oxoacids ChEBI chalcogen oxoacids chebi chalcogen oxoanion chebi_ontology chalcogen oxoanion chalcogen oxoanions CHEBI:33485 chalcogen oxoanion chalcogen oxoanion ChEBI chalcogen oxoanion chebi chalcogen oxoanions ChEBI chalcogen oxoanions chebi A molecular entity containing one or more atoms of a transition element. chebi_ontology transition element molecular entities transition metal molecular entity CHEBI:33497 transition element molecular entity transition element molecular entities ChEBI transition element molecular entities chebi transition metal molecular entity ChEBI transition metal molecular entity chebi chebi_ontology alkali metal cations CHEBI:33504 alkali metal cation alkali metal cations ChEBI alkali metal cations chebi alkaline earth cations alkaline earth metal cation alkaline-earth metal cations CHEBI:33513 alkaline earth cation alkaline earth cations ChEBI alkaline earth metal cation ChEBI alkaline-earth metal cations ChEBI transition element cations transition metal cation CHEBI:33515 transition element cation transition element cations ChEBI transition metal cation ChEBI An atom of an element that exhibits typical metallic properties, being typically shiny, with high electrical and thermal conductivity. CHEBI:25217 CHEBI:6788 KEGG:C00050 Wikipedia:Metal chebi_ontology elemental metal elemental metals metal element metal elements metals CHEBI:33521 metal atom elemental metal ChEBI elemental metal chebi elemental metals ChEBI elemental metals chebi metal element ChEBI metal element chebi metal elements ChEBI metal elements chebi metals ChEBI metals chebi chebi_ontology hydrides of sulfur sulfur hydride sulfur hydrides sulphur hydrides CHEBI:33535 sulfur hydride hydrides of sulfur chebi sulfur hydride chebi sulfur hydrides chebi sulphur hydrides chebi The sulfur oxoanion formed by deprotonation of sulfonic acid. chebi_ontology SHO3(-) [SHO3](-) sulfonates CHEBI:33543 sulfonate SHO3(-) iupac [SHO3](-) iupac sulfonates chebi An organic derivative of sulfonic acid in which the sulfo group is linked directly to carbon. chebi_ontology organosulfonic acids sulfonic acids CHEBI:33551 organosulfonic acid organosulfonic acids chebi sulfonic acids chebi chebi_ontology derivatives of sulfonic acid sulfonic acid derivative sulfonic acid derivatives CHEBI:33552 sulfonic acid derivative derivatives of sulfonic acid chebi sulfonic acid derivative chebi sulfonic acid derivatives chebi An organic anion obtained by deprotonation of the sufonate group(s) of any organosulfonic acid. chebi_ontology organosulfonate organosulfonate oxoanions organosulfonates CHEBI:33554 organosulfonate oxoanion organosulfonate chebi organosulfonate oxoanions chebi organosulfonates chebi An amino-acid anion obtained by deprotonation of any alpha-amino acid. An amino-acid anion obtained by deprotonation of any α-amino acid. chebi_ontology alpha-amino acid anion alpha-amino acid anions alpha-amino-acid anions CHEBI:33558 alpha-amino-acid anion alpha-amino acid anion ChEBI alpha-amino acid anion chebi alpha-amino acid anions ChEBI alpha-amino acid anions chebi alpha-amino-acid anions ChEBI alpha-amino-acid anions chebi chebi_ontology s-block element s-block elements CHEBI:33559 s-block element atom s-block element ChEBI s-block element chebi s-block elements ChEBI s-block elements chebi Any main group element atom belonging to the p-block of the periodic table. chebi_ontology p-block element p-block elements CHEBI:33560 p-block element atom p-block element ChEBI p-block element chebi p-block elements ChEBI p-block elements chebi chebi_ontology d-block element d-block elements CHEBI:33561 d-block element atom d-block element ChEBI d-block element chebi d-block elements ChEBI d-block elements chebi Any member of class of 1,2-di-<em>O</em>-acylglycerols joined at oxygen 3 by a glycosidic linkage to a carbohydrate part (usually a mono-, di- or tri-saccharide). Some substances classified as bacterial glycolipids have the sugar part acylated by one or more fatty acids and the glycerol part may be absent. Any member of class of 1,2-di-O-acylglycerols joined at oxygen 3 by a glycosidic linkage to a carbohydrate part (usually a mono-, di- or tri-saccharide). Some substances classified as bacterial glycolipids have the sugar part acylated by one or more fatty acids and the glycerol part may be absent. CHEBI:24393 CHEBI:5476 KEGG:C05005 Wikipedia:Glycolipids Glycolipid chebi_ontology Glycolipid a glycolipid CHEBI:33563 glycolipid Glycolipid KEGG_COMPOUND Glycolipid kegg.compound a glycolipid UniProt a glycolipid uniprot_ft Any compound containing an <em>o</em>-diphenol component. Any compound containing an o-diphenol component. CHEBI:134187 CHEBI:13628 CHEBI:18862 KEGG:C15571 chebi_ontology 1,2-benzenediols a catechol benzene-1,2-diols CHEBI:33566 catechols 1,2-benzenediols ChEBI 1,2-benzenediols chebi a catechol UniProt a catechol uniprot_ft benzene-1,2-diols ChEBI benzene-1,2-diols chebi 4-(2-Aminoethyl)pyrocatechol [4-(2-aminoethyl)benzene-1,2-diol] and derivatives formed by substitution. CHEBI:23056 CHEBI:3468 KEGG:C02012 Catecholamine chebi_ontology Catecholamine catecholamines CHEBI:33567 catecholamine Catecholamine KEGG_COMPOUND Catecholamine kegg.compound catecholamines ChEBI catecholamines chebi A racemate comprising equimolar amounts of (<i>R</i>)-adrenaline and (<i>S</i>)-adrenaline. chebi_ontology (+-)-adrenaline (+-)-epinephrine 2-(methylamino)-1-(3,4-dihydroxyphenyl)ethanol dl-adrenaline epinephrine racemic rac-adrenaline racemic adrenaline CHEBI:33568 adrenaline (+-)-adrenaline iuphar (+-)-epinephrine chemidplus 2-(methylamino)-1-(3,4-dihydroxyphenyl)ethanol chemidplus dl-adrenaline chemidplus epinephrine racemic chemidplus rac-adrenaline chebi racemic adrenaline chebi A catecholamine in which C-1 of the aminoethyl side-chain is hydroxy-substituted. LINCS:LSM-5181 chebi_ontology noradrenalina norepinephrine CHEBI:33569 noradrenaline noradrenalina ChEBI noradrenalina chebi norepinephrine ChEBI norepinephrine chebi CHEBI:22705 CHEBI:22711 chebi_ontology CHEBI:33570 benzenediols The S-enantiomer of noradrenaline. LINCS:LSM-37072 CHEBI:33571 (S)-noradrenaline A carbon oxoacid acid carrying at least one -C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid. A carbon oxoacid acid carrying at least one ‒C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid. CHEBI:13428 CHEBI:13627 CHEBI:23027 Wikipedia:Carboxylic_acid chebi_ontology Carbonsaeure Carbonsaeuren Karbonsaeure RC(=O)OH acide carboxylique acides carboxyliques acido carboxilico acidos carboxilicos CHEBI:33575 carboxylic acid Carbonsaeure ChEBI Carbonsaeure chebi Carbonsaeuren ChEBI Carbonsaeuren chebi Karbonsaeure ChEBI Karbonsaeure chebi RC(=O)OH IUPAC RC(=O)OH iupac acide carboxylique IUPAC acide carboxylique iupac acides carboxyliques IUPAC acides carboxyliques iupac acido carboxilico IUPAC acido carboxilico iupac acidos carboxilicos IUPAC acidos carboxilicos iupac Any carboxylic acid having a sulfur substituent. chebi_ontology S-containing carboxylic acid S-containing carboxylic acids sulfur-containing carboxylic acids CHEBI:33576 sulfur-containing carboxylic acid S-containing carboxylic acid chebi S-containing carboxylic acids chebi sulfur-containing carboxylic acids chebi A molecular entity containing one or more atoms from any of groups 1, 2, 13, 14, 15, 16, 17, and 18 of the periodic table. chebi_ontology main group compounds main group molecular entities CHEBI:33579 main group molecular entity main group compounds ChEBI main group compounds chebi main group molecular entities ChEBI main group molecular entities chebi carbon group molecular entity chebi_ontology carbon group molecular entities carbon group molecular entity CHEBI:33582 carbon group molecular entity carbon group molecular entity ChEBI carbon group molecular entities ChEBI carbon group molecular entities chebi carbon group molecular entity chebi Any molecule that consists of a series of atoms joined together to form a ring. Wikipedia:Cyclic_compound chebi_ontology cyclic compounds CHEBI:33595 cyclic compound cyclic compounds ChEBI cyclic compounds chebi A cyclic compound having as ring members atoms of the same element only. chebi_ontology isocyclic compounds CHEBI:33597 homocyclic compound isocyclic compounds IUPAC isocyclic compounds iupac A homocyclic compound in which all of the ring members are carbon atoms. chebi_ontology carbocycle CHEBI:33598 carbocyclic compound carbocycle ChEBI carbocycle chebi chebi_ontology hydrogen compounds hydrogen molecular entities CHEBI:33608 hydrogen molecular entity hydrogen compounds ChEBI hydrogen compounds chebi hydrogen molecular entities ChEBI hydrogen molecular entities chebi chebi_ontology polycyclic compounds CHEBI:33635 polycyclic compound polycyclic compounds ChEBI polycyclic compounds chebi A molecule that features two fused rings. chebi_ontology bicyclic compounds CHEBI:33636 bicyclic compound bicyclic compounds ChEBI bicyclic compounds chebi Acyclic and cyclic hydrocarbons having one or more carbon-carbon double bonds, apart from the formal ones in aromatic compounds. The class olefins subsumes alkenes and cycloalkenes and the corresponding polyenes. chebi_ontology olefins CHEBI:33641 olefin olefins chebi Acyclic branched or unbranched hydrocarbons having one or more carbon-carbon double bond. chebi_ontology acyclic olefins CHEBI:33645 acyclic olefin acyclic olefins chebi Any acyclic or cyclic, saturated or unsaturated carbon compound, excluding aromatic compounds. chebi_ontology CHEBI:33653 aliphatic compound A cyclically conjugated molecular entity with a stability (due to delocalization) significantly greater than that of a hypothetical localized structure (e.g. Kekule structure) is said to possess aromatic character. A cyclically conjugated molecular entity with a stability (due to delocalization) significantly greater than that of a hypothetical localized structure (e.g. Kekulé structure) is said to possess aromatic character. chebi_ontology aromatics aromatische Verbindungen CHEBI:33655 aromatic compound aromatics ChEBI aromatics chebi aromatische Verbindungen ChEBI aromatische Verbindungen chebi Any monocyclic or polycyclic aromatic hydrocarbon. chebi_ontology aromatic hydrocarbons CHEBI:33658 arene aromatic hydrocarbons IUPAC aromatic hydrocarbons iupac chebi_ontology organic aromatic compounds CHEBI:33659 organic aromatic compound organic aromatic compounds ChEBI organic aromatic compounds chebi chebi_ontology monocyclic compounds CHEBI:33661 monocyclic compound monocyclic compounds ChEBI monocyclic compounds chebi A mancude monocyclic hydrocarbon without side chains of the general formula C<small>_<em>n</em></small>H<small>_<em>n</em></small> (<em>n</em> is an even number) or C<small>_<em>n</em></small>H<small>_<em>n</em>+1</small> (<em>n</em> is an odd number). In systematic nomenclature an annulene with seven or more carbon atoms may be named [<em>n</em>]annulene, where <em>n</em> is the number of carbon atoms. A mancude monocyclic hydrocarbon without side chains of the general formula CnHn (n is an even number) or CnHn+1 (n is an odd number). In systematic nomenclature an annulene with seven or more carbon atoms may be named [n]annulene, where n is the number of carbon atoms. chebi_ontology CHEBI:33662 annulene cyclic hydrocarbon chebi_ontology cyclic hydrocarbon cyclic hydrocarbons CHEBI:33663 cyclic hydrocarbon cyclic hydrocarbon ChEBI cyclic hydrocarbon chebi cyclic hydrocarbons ChEBI cyclic hydrocarbons chebi monocyclic hydrocarbon chebi_ontology monocyclic hydrocarbon monocyclic hydrocarbons CHEBI:33664 monocyclic hydrocarbon monocyclic hydrocarbon ChEBI monocyclic hydrocarbon chebi monocyclic hydrocarbons ChEBI monocyclic hydrocarbons chebi chebi_ontology CHEBI:33670 heteromonocyclic compound A polycyclic compound in which at least one of the rings contains at least one non-carbon atom. chebi_ontology polyheterocyclic compounds CHEBI:33671 heteropolycyclic compound polyheterocyclic compounds ChEBI polyheterocyclic compounds chebi A bicyclic compound in which at least one of the rings contains at least one skeletal heteroatom. chebi_ontology CHEBI:33672 heterobicyclic compound An s-block molecular entity is a molecular entity containing one or more atoms of an s-block element. s-block molecular entity chebi_ontology s-block compounds s-block molecular entities s-block molecular entity CHEBI:33674 s-block molecular entity s-block molecular entity ChEBI s-block compounds ChEBI s-block compounds chebi s-block molecular entities ChEBI s-block molecular entities chebi s-block molecular entity chebi A main group molecular entity that contains one or more atoms of a p-block element. chebi_ontology p-block compounds p-block molecular entities p-block molecular entitiy CHEBI:33675 p-block molecular entity p-block compounds ChEBI p-block compounds chebi p-block molecular entities ChEBI p-block molecular entities chebi p-block molecular entitiy ChEBI p-block molecular entitiy chebi A d-block molecular entity is a molecular entity containing one or more atoms of a d-block element. d-block molecular entity chebi_ontology d-block compounds d-block molecular entities d-block molecular entity CHEBI:33676 d-block molecular entity d-block molecular entity ChEBI d-block compounds ChEBI d-block compounds chebi d-block molecular entities ChEBI d-block molecular entities chebi d-block molecular entity chebi Hydrides are chemical compounds of hydrogen with other chemical elements. chebi_ontology CHEBI:33692 hydrides oxygen hydride chebi_ontology hydrides of oxygen oxygen hydride oxygen hydrides CHEBI:33693 oxygen hydride oxygen hydride ChEBI hydrides of oxygen ChEBI hydrides of oxygen chebi oxygen hydride chebi oxygen hydrides ChEBI oxygen hydrides chebi A macromolecule formed by a living organism. chebi_ontology Biopolymere biomacromolecules biopolymers CHEBI:33694 biomacromolecule Biopolymere ChEBI Biopolymere chebi biomacromolecules ChEBI biomacromolecules chebi biopolymers ChEBI biopolymers chebi chebi_ontology genetically encoded biomacromolecules genetically encoded biopolymers information biomacromolecules information biopolymers information macromolecule information macromolecules CHEBI:33695 information biomacromolecule genetically encoded biomacromolecules ChEBI genetically encoded biomacromolecules chebi genetically encoded biopolymers ChEBI genetically encoded biopolymers chebi information biomacromolecules ChEBI information biomacromolecules chebi information biopolymers ChEBI information biopolymers chebi information macromolecule ChEBI information macromolecule chebi information macromolecules ChEBI information macromolecules chebi A macromolecule made up of nucleotide units and hydrolysable into certain pyrimidine or purine bases (usually adenine, cytosine, guanine, thymine, uracil), D-ribose or 2-deoxy-D-ribose and phosphoric acid. NA Nukleinsaeure Nukleinsaeuren acide nucleique acides nucleiques acido nucleico acidos nucleicos CHEBI:33696 nucleic acid NA ChEBI Nukleinsaeure ChEBI Nukleinsaeuren ChEBI acide nucleique ChEBI acides nucleiques ChEBI acido nucleico ChEBI acidos nucleicos ChEBI High molecular weight, linear polymers, composed of nucleotides containing ribose and linked by phosphodiester bonds; RNA is central to the synthesis of proteins. ribonucleic acid RNA RNS Ribonukleinsaeure pentosenucleic acids ribonucleic acids ribose nucleic acid yeast nucleic acid CHEBI:33697 ribonucleic acid ribonucleic acid IUPAC RNA IUPAC UniProt RNS ChEBI Ribonukleinsaeure ChEBI pentosenucleic acids ChemIDplus ribonucleic acids ChEBI ribose nucleic acid ChEBI yeast nucleic acid ChEBI chebi_ontology canonical amino-acid residue canonical amino-acid residues common amino acid residues proteinogenic amino-acid residues standard amino acid residues standard amino-acid residues CHEBI:33700 proteinogenic amino-acid residue canonical amino-acid residue ChEBI canonical amino-acid residue chebi canonical amino-acid residues ChEBI canonical amino-acid residues chebi common amino acid residues ChEBI common amino acid residues chebi proteinogenic amino-acid residues ChEBI proteinogenic amino-acid residues chebi standard amino acid residues ChEBI standard amino acid residues chebi standard amino-acid residues ChEBI standard amino-acid residues chebi A cation consisting of more than one atom. chebi_ontology polyatomic cations CHEBI:33702 polyatomic cation polyatomic cations ChEBI polyatomic cations chebi chebi_ontology amino acid cation amino acid cations amino-acid cations CHEBI:33703 amino-acid cation amino acid cation ChEBI amino acid cation chebi amino acid cations ChEBI amino acid cations chebi amino-acid cations ChEBI amino-acid cations chebi An amino acid in which the amino group is located on the carbon atom at the position alpha to the carboxy group. An amino acid in which the amino group is located on the carbon atom at the position α to the carboxy group. CHEBI:10208 CHEBI:13779 CHEBI:22442 CHEBI:2642 KEGG:C00045 KEGG:C05167 chebi_ontology Amino acid Amino acids alpha-amino acids alpha-amino carboxylic acids CHEBI:33704 alpha-amino acid Amino acid KEGG_COMPOUND Amino acid kegg.compound Amino acids KEGG_COMPOUND Amino acids kegg.compound alpha-amino acids ChEBI JCBN alpha-amino acids chebi jcbn alpha-amino carboxylic acids IUPAC alpha-amino carboxylic acids iupac A non-proteinogenic amino acid in which the amino group is located on the carbon atom at the position β to the carboxy group. chebi_ontology beta-amino acid beta-amino acids CHEBI:33706 beta-amino acid beta-amino acid chebi beta-amino acids chebi A non-proteinogenic amino-acid in which the amino group is located on the carbon atom at the position gamma to the carboxy group. A non-proteinogenic amino-acid in which the amino group is located on the carbon atom at the position γ to the carboxy group. gamma-amino acid chebi_ontology gamma-amino acid gamma-amino acids CHEBI:33707 gamma-amino acid gamma-amino acid ChEBI gamma-amino acid chebi gamma-amino acids ChEBI gamma-amino acids chebi When two or more amino acids combine to form a peptide, the elements of water are removed, and what remains of each amino acid is called an amino-acid residue. chebi_ontology protein amino acid residue amino acid residues amino-acid residues CHEBI:33708 amino-acid residue amino acid residue ChEBI amino acid residue chebi amino acid residues ChEBI amino acid residues chebi amino-acid residues JCBN amino-acid residues jcbn A carboxylic acid containing one or more amino groups. CHEBI:13815 CHEBI:22477 Wikipedia:Amino_acid chebi_ontology Aminocarbonsaeure Aminokarbonsaeure Aminosaeure amino acids CHEBI:33709 amino acid Aminocarbonsaeure ChEBI Aminocarbonsaeure chebi Aminokarbonsaeure ChEBI Aminokarbonsaeure chebi Aminosaeure ChEBI Aminosaeure chebi amino acids ChEBI amino acids chebi An amino-acid residue derived from an alpha-amino acid. An amino-acid residue derived from an α-amino acid. chebi_ontology alpha-amino-acid residues an alpha-amino acid residue CHEBI:33710 alpha-amino-acid residue alpha-amino-acid residues ChEBI alpha-amino-acid residues chebi an alpha-amino acid residue UniProt an alpha-amino acid residue uniprot_ft chebi_ontology alpha-amino acid cation alpha-amino acid cations alpha-amino-acid cations CHEBI:33719 alpha-amino-acid cation alpha-amino acid cation ChEBI alpha-amino acid cation chebi alpha-amino acid cations ChEBI alpha-amino acid cations chebi alpha-amino-acid cations ChEBI alpha-amino-acid cations chebi carbohydrate acid chebi_ontology carbohydrate acid carbohydrate acids CHEBI:33720 carbohydrate acid carbohydrate acid ChEBI carbohydrate acid chebi carbohydrate acids ChEBI carbohydrate acids chebi carbohydrate acid anion chebi_ontology carbohydrate acid anion carbohydrate acid anions CHEBI:33721 carbohydrate acid anion carbohydrate acid anion ChEBI carbohydrate acid anion chebi carbohydrate acid anions ChEBI carbohydrate acid anions chebi iron group molecular entity chebi_ontology iron group molecular entities iron group molecular entity CHEBI:33744 iron group molecular entity iron group molecular entity ChEBI iron group molecular entities ChEBI iron group molecular entities chebi iron group molecular entity chebi chebi_ontology copper group molecular entities copper group molecular entity CHEBI:33745 copper group molecular entity copper group molecular entities chebi copper group molecular entity chebi canonical nucleoside residues common nucleoside residues nucleoside residue standard nucleoside residues CHEBI:33791 canonical nucleoside residue canonical nucleoside residues ChEBI common nucleoside residues CBN nucleoside residue CBN standard nucleoside residues ChEBI N Nuc canonical ribonucleoside residues common ribonucleoside residue common ribonucleoside residues standard ribonucleoside residues CHEBI:33792 canonical ribonucleoside residue N CBN Nuc CBN canonical ribonucleoside residues ChEBI common ribonucleoside residue CBN common ribonucleoside residues CBN standard ribonucleoside residues ChEBI canonical deoxyribonucleoside residues common 2'-deoxyribonucleoside residue common 2'-deoxyribonucleoside residues dN dNuc standard deoxyribonucleoside residues CHEBI:33793 canonical deoxyribonucleoside residue canonical deoxyribonucleoside residues ChEBI common 2'-deoxyribonucleoside residue CBN common 2'-deoxyribonucleoside residues CBN dN CBN dNuc CBN standard deoxyribonucleoside residues ChEBI An organic compound having at least one hydroxy group attached to a carbon atom. CHEBI:64710 chebi_ontology organic alcohol organic hydroxy compounds CHEBI:33822 organic hydroxy compound organic alcohol ChEBI organic alcohol chebi organic hydroxy compounds ChEBI organic hydroxy compounds chebi Any organic molecule that consists of atoms connected in the form of a ring. chebi_ontology organic cyclic compounds CHEBI:33832 organic cyclic compound organic cyclic compounds ChEBI organic cyclic compounds chebi A heterocyclic compound formally derived from an arene by replacement of one or more methine (-C=) and/or vinylene (-CH=CH-) groups by trivalent or divalent heteroatoms, respectively, in such a way as to maintain the continuous pi-electron system characteristic of aromatic systems and a number of out-of-plane pi-electrons corresponding to the Hueckel rule (4n+2). A heterocyclic compound formally derived from an arene by replacement of one or more methine (‒C=) and/or vinylene (‒CH=CH‒) groups by trivalent or divalent heteroatoms, respectively, in such a way as to maintain the continuous π-electron system characteristic of aromatic systems and a number of out-of-plane π-electrons corresponding to the Hückel rule (4<em>n</em>+2). chebi_ontology hetarenes CHEBI:33833 heteroarene hetarenes IUPAC hetarenes iupac chebi_ontology benzenoid aromatic compounds benzenoid compound CHEBI:33836 benzenoid aromatic compound benzenoid aromatic compounds ChEBI benzenoid aromatic compounds chebi benzenoid compound ChEBI benzenoid compound chebi Conjugated protein is a protein that contains a non-peptide component, usually in stoichiometric proportion. COMe:PRX000001 chebi_ontology complex protein CHEBI:33837 conjugated protein complex protein COMe An <em>N</em>-glycosyl compound that has both a nucleobase, normally adenine, guanine, xanthine, thymine, cytosine or uracil, and either a ribose or deoxyribose as functional parents. An N-glycosyl compound that has both a nucleobase, normally adenine, guanine, xanthine, thymine, cytosine or uracil, and either a ribose or deoxyribose as functional parents. CHEBI:13661 CHEBI:25611 CHEBI:7647 KEGG:C00801 Wikipedia:Nucleoside Nucleoside chebi_ontology Nucleoside a nucleoside nucleosides CHEBI:33838 nucleoside Nucleoside KEGG_COMPOUND Nucleoside kegg.compound a nucleoside UniProt a nucleoside uniprot_ft nucleosides ChEBI nucleosides chebi A macromolecule is a molecule of high relative molecular mass, the structure of which essentially comprises the multiple repetition of units derived, actually or conceptually, from molecules of low relative molecular mass. Wikipedia:Macromolecule chebi_ontology macromolecules polymer polymer molecule polymers CHEBI:33839 macromolecule macromolecules ChEBI macromolecules chebi polymer ChEBI polymer chebi polymer molecule IUPAC polymer molecule iupac polymers ChEBI polymers chebi chebi_ontology aromatic annulenes CHEBI:33842 aromatic annulene aromatic annulenes ChEBI aromatic annulenes chebi A monocyclic aromatic hydrocarbon. chebi_ontology monocyclic arenes CHEBI:33847 monocyclic arene monocyclic arenes ChEBI monocyclic arenes chebi Organic aromatic compounds having one or more hydroxy groups attached to a benzene or other arene ring. CHEBI:13664 CHEBI:13825 CHEBI:25969 CHEBI:2857 CHEBI:29322 KEGG:C15584 MetaCyc:Phenols Wikipedia:Phenols chebi_ontology Aryl alcohol a phenol arenols CHEBI:33853 phenols Aryl alcohol KEGG_COMPOUND Aryl alcohol kegg.compound a phenol UniProt a phenol uniprot_ft arenols IUPAC arenols iupac An amino acid whose structure includes an aromatic ring. CHEBI:13820 CHEBI:22623 CHEBI:2835 KEGG:C01021 Wikipedia:Aromatic_amino_acid Aromatic amino acid chebi_ontology Aromatic amino acid aromatic amino acids CHEBI:33856 aromatic amino acid Aromatic amino acid KEGG_COMPOUND Aromatic amino acid kegg.compound aromatic amino acids ChEBI aromatic amino acids chebi Any carboxylic acid in which the carboxy group is directly bonded to an aromatic ring. CHEBI:13817 CHEBI:13821 CHEBI:2830 chebi_ontology aromatic carboxylic acids CHEBI:33859 aromatic carboxylic acid aromatic carboxylic acids chebi An amino compound in which the amino group is linked directly to an aromatic system. CHEBI:13827 CHEBI:22622 CHEBI:22646 CHEBI:2834 CHEBI:2863 chebi_ontology aromatic amines aryl amine aryl amines arylamine arylamines CHEBI:33860 aromatic amine aromatic amines chebi aryl amine chebi aryl amines chebi arylamine chebi arylamines chebi chebi_ontology transition element coordination entities transition metal coordination compounds transition metal coordination entities CHEBI:33861 transition element coordination entity transition element coordination entities chebi transition metal coordination compounds chebi transition metal coordination entities chebi chebi_ontology iron coordination compounds iron coordination entities iron coordination entity CHEBI:33892 iron coordination entity iron coordination compounds chebi iron coordination entities chebi iron coordination entity chebi A substance used in a chemical reaction to detect, measure, examine, or produce other substances. chebi_ontology reactif reactivo reagents CHEBI:33893 reagent reactif IUPAC reactif iupac reactivo IUPAC reactivo iupac reagents ChEBI reagents chebi chebi_ontology metal-tetrapyrrole metal-tetrapyrrole complex metallotetrapyrroles CHEBI:33909 metallotetrapyrrole metal-tetrapyrrole chebi metal-tetrapyrrole complex chebi metallotetrapyrroles chebi A pentose with a (potential) aldehyde group at one end. aldopentose chebi_ontology aldopentose aldopentoses CHEBI:33916 aldopentose aldopentose ChEBI aldopentose chebi aldopentoses ChEBI aldopentoses chebi A hexose with a (potential) aldehyde group at one end. CHEBI:2558 aldohexose chebi_ontology aldohexose aldohexoses CHEBI:33917 aldohexose aldohexose ChEBI aldohexose chebi aldohexoses ChEBI aldohexoses chebi Any nutrient required in large quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Macronutrients are usually chemical elements (carbon, hydrogen, nitrogen, oxygen, phosphorus and sulfur) that humans consume in the largest quantities. Calcium, sodium, magnesium and potassium are sometimes included as macronutrients because they are required in relatively large quantities compared with other vitamins and minerals. chebi_ontology macronutrients CHEBI:33937 macronutrient macronutrients ChEBI macronutrients chebi Any aldopentose where the open-chain form has all the hydroxy groups on the same side in the Fischer projection. Occurrs in two enantiomeric forms, <small>D</small>- and <small>L</small>-ribose, of which only the former is found in nature. Any aldopentose where the open-chain form has all the hydroxy groups on the same side in the Fischer projection. Occurrs in two enantiomeric forms, D- and L-ribose, of which only the former is found in nature. CHEBI:26564 chebi_ontology Rib CHEBI:33942 ribose Rib JCBN Rib jcbn A quaternary ammonium ion that is the the conjugate acid of carnitine. chebi_ontology 3-hydroxy-4-(trimethylammonio)butanoic acid Carnitine CHEBI:3424 carnitinium 3-hydroxy-4-(trimethylammonio)butanoic acid chebi Carnitine kegg.compound An ammonium ion that is the conjugate acid of serotonin; major species at pH 7.3. chebi_ontology serotonin serotonin cation CHEBI:350546 serotonin(1+) serotonin UniProt serotonin uniprot_ft serotonin cation ChEBI serotonin cation chebi chebi_ontology nitrogen hydrides CHEBI:35106 nitrogen hydride nitrogen hydrides ChEBI nitrogen hydrides chebi Saturated acyclic nitrogen hydrides having the general formula N<small>_<em>n</em></small>H<small>_<em>n</em>+2</small>. Saturated acyclic nitrogen hydrides having the general formula NnHn+2. chebi_ontology azanes CHEBI:35107 azane azanes ChEBI azanes chebi chebi_ontology aldose phosphates CHEBI:35131 aldose phosphate aldose phosphates ChEBI aldose phosphates chebi chebi_ontology metalloproteine metalloproteins CHEBI:35134 metalloprotein metalloproteine chebi metalloproteins chebi chebi_ontology iron proteins iron-containing proteins CHEBI:35136 iron protein iron proteins chebi iron-containing proteins chebi Conjugated proteins containing heme as the prosthetic group. chebi_ontology Haemoprotein Haemprotein haemoprotein heme protein hemeproteins hemoprotein hemoproteins CHEBI:35137 hemoprotein Haemoprotein chebi Haemprotein chebi haemoprotein chebi heme protein chebi hemeproteins iubmb hemoprotein chebi hemoproteins chebi chebi_ontology haemoglobin hemoglobin CHEBI:35143 hemoglobin haemoglobin chebi hemoglobin chebi CHEBI:35155 elemental calcium Kalziumsalz Kalziumsalze calcium salts CHEBI:35156 calcium salt Kalziumsalz ChEBI Kalziumsalze ChEBI calcium salts ChEBI A hydrocarbon of biological origin having carbon skeleton formally derived from isoprene [CH2=C(CH3)CH=CH2]. A hydrocarbon of biological origin having carbon skeleton formally derived from isoprene [CH<small>₂</small>=C(CH<small>₃</small>)CH=CH<small>₂</small>]. terpene chebi_ontology Terpen terpene terpenes terpeno terpenos CHEBI:35186 terpene terpene IUPAC Terpen ChEBI Terpen chebi terpene iupac terpenes IUPAC terpenes iupac terpeno IUPAC terpeno iupac terpenos IUPAC terpenos iupac A C<small>₂₀</small> terpene. chebi_ontology Diterpen diterpenes diterpeno diterpenos CHEBI:35190 diterpene Diterpen chebi diterpenes iupac diterpeno iupac diterpenos iupac A C30 terpene. Triterpen triterpenes triterpeno triterpenos CHEBI:35191 triterpene Triterpen ChEBI triterpenes IUPAC triterpeno IUPAC triterpenos IUPAC A substance which lowers the surface tension of the medium in which it is dissolved, and/or the interfacial tension with other phases, and, accordingly, is positively adsorbed at the liquid/vapour and/or at other interfaces. chebi_ontology surface active agent surfactants CHEBI:35195 surfactant surface active agent iupac surfactants chebi A substance that diminishes the rate of a chemical reaction. chebi_ontology inhibidor inhibiteur inhibitors CHEBI:35222 inhibitor inhibidor ChEBI inhibidor chebi inhibiteur ChEBI inhibiteur chebi inhibitors ChEBI inhibitors chebi A substance that increases the rate of a reaction without modifying the overall standard Gibbs energy change in the reaction. chebi_ontology Katalysator catalizador catalyseur CHEBI:35223 catalyst Katalysator ChEBI Katalysator chebi catalizador ChEBI catalizador chebi catalyseur ChEBI catalyseur chebi A fuel such as coal, oil and natural gas which has formed over many years through the decomposition of deposited vegetation which was under extreme pressure of an overburden of earth. chebi_ontology CHEBI:35230 fossil fuel chebi_ontology (2R)-2-ammonio-3-mercaptopropanoate L-cysteine L-cysteine zwitterion CHEBI:35235 L-cysteine zwitterion (2R)-2-ammonio-3-mercaptopropanoate chebi L-cysteine uniprot_ft L-cysteine zwitterion iupac chebi_ontology (2S)-2-ammonio-3-mercaptopropanoate D-cysteine D-cysteine zwitterion CHEBI:35236 D-cysteine zwitterion (2S)-2-ammonio-3-mercaptopropanoate chebi D-cysteine uniprot_ft D-cysteine zwitterion iupac chebi_ontology (+)H3N-CH(CH2SH)-COO(-) 2-ammonio-3-mercaptopropanoate cysteine zwitterion CHEBI:35237 cysteine zwitterion (+)H3N-CH(CH2SH)-COO(-) chebi 2-ammonio-3-mercaptopropanoate chebi cysteine zwitterion iupac The zwitterionic form of an amino acid having a negatively charged carboxyl group and a positively charged amino group. chebi_ontology amino acid zwitterion amino acid zwitterions amino-acid zwitterions CHEBI:35238 amino-acid zwitterion amino acid zwitterion ChEBI amino acid zwitterion chebi amino acid zwitterions ChEBI amino acid zwitterions chebi amino-acid zwitterions ChEBI amino-acid zwitterions chebi An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of serine. chebi_ontology serine zwitterion CHEBI:35243 serine zwitterion serine zwitterion iupac A derivative of ammonium, NH4(+), in which all four of the hydrogens bonded to nitrogen have been replaced with univalent (usually organyl) groups. A derivative of ammonium, NH<small>₄</small><small>^+</small>, in which all four of the hydrogens bonded to nitrogen have been replaced with univalent (usually organyl) groups. CHEBI:26470 CHEBI:8693 KEGG:C06703 chebi_ontology Quaternary amine a quaternary ammonium quaternary ammonium ions CHEBI:35267 quaternary ammonium ion Quaternary amine KEGG_COMPOUND Quaternary amine kegg.compound a quaternary ammonium UniProt a quaternary ammonium uniprot_ft quaternary ammonium ions ChEBI quaternary ammonium ions chebi A derivative of ammonium, NH4(+), in which one (or more) of the hydrogens bonded to the nitrogen have been replaced with univalent organyl groups. The substituting carbon of the organyl group must not itself be directly attached to a heteroatom (thereby excluding protonated amides, hemiaminals, etc). A derivative of ammonium, NH<small>₄</small><small>^+</small>, in which one (or more) of the hydrogens bonded to the nitrogen have been replaced with univalent organyl groups. The substituting carbon of the organyl group must not itself be directly attached to a heteroatom (thereby excluding protonated amides, hemiaminals, etc). chebi_ontology ammonium ion derivatives azanium ion derivative azanium ion derivatives CHEBI:35274 ammonium ion derivative ammonium ion derivatives ChEBI ammonium ion derivatives chebi azanium ion derivative ChEBI azanium ion derivative chebi azanium ion derivatives ChEBI azanium ion derivatives chebi Neutral molecules having charge-separated forms with an onium atom which bears no hydrogen atoms and that is not adjacent to the anionic atom. chebi_ontology onium betaines CHEBI:35281 onium betaine onium betaines ChEBI onium betaines chebi Any neutral molecule having charge-separated forms with a quaternary ammonium atom which bears no hydrogen atoms and that is not adjacent to the anionic atom. chebi_ontology ammonium betaines CHEBI:35284 ammonium betaine ammonium betaines ChEBI ammonium betaines chebi A choline ester formed from choline and a carboxylic acid. CHEBI:13245 CHEBI:22227 CHEBI:2463 KEGG:C01777 chebi_ontology acylcholines an acylcholine CHEBI:35287 acylcholine acylcholines ChEBI acylcholines chebi an acylcholine UniProt an acylcholine uniprot_ft Any of naturally occurring compounds and synthetic analogues, based on the cyclopenta[<em>a</em>]phenanthrene carbon skeleton, partially or completely hydrogenated; there are usually methyl groups at C-10 and C-13, and often an alkyl group at C-17. By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred. Natural steroids are derived biogenetically from squalene which is a triterpene. Any of naturally occurring compounds and synthetic analogues, based on the cyclopenta[a]phenanthrene carbon skeleton, partially or completely hydrogenated; there are usually methyl groups at C-10 and C-13, and often an alkyl group at C-17. By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred. Natural steroids are derived biogenetically from squalene which is a triterpene. CHEBI:13687 CHEBI:26768 CHEBI:9263 KEGG:C00377 MetaCyc:Steroids Steroid chebi_ontology Steroid a steroid CHEBI:35341 steroid Steroid KEGG_COMPOUND Steroid kegg.compound a steroid UniProt a steroid uniprot_ft A 17-hydroxy steroid in which the hydroxy group at position 17 has a beta-configuration. A 17-hydroxy steroid in which the hydroxy group at position 17 has a β-configuration. CHEBI:19176 CHEBI:794 KEGG:C03051 MetaCyc:17-beta-Hydroxysteroids chebi_ontology 17beta-hydroxy steroids 17beta-hydroxysteroid 17beta-hydroxysteroids a 17-beta-hydroxy steroid a 17beta-hydroxy steroid CHEBI:35343 17beta-hydroxy steroid 17beta-hydroxy steroids ChEBI 17beta-hydroxy steroids chebi 17beta-hydroxysteroid KEGG_COMPOUND 17beta-hydroxysteroid kegg.compound 17beta-hydroxysteroids ChEBI 17beta-hydroxysteroids chebi a 17-beta-hydroxy steroid uniprot_ft a 17beta-hydroxy steroid UniProt CHEBI:1300 CHEBI:13596 CHEBI:19803 KEGG:C02506 chebi_ontology 21-Hydroxysteroid 21-hydroxy steroids 21-hydroxysteroids CHEBI:35344 21-hydroxy steroid 21-Hydroxysteroid KEGG_COMPOUND 21-Hydroxysteroid kegg.compound 21-hydroxy steroids ChEBI 21-hydroxy steroids chebi 21-hydroxysteroids ChEBI 21-hydroxysteroids chebi Any 11-hydroxy steroid in which the hydroxy group at position 11 has beta- configuration. Any 11-hydroxy steroid in which the hydroxy group at position 11 has β- configuration. CHEBI:13774 CHEBI:19134 CHEBI:738 KEGG:C01058 chebi_ontology 11beta-Hydroxysteroid 11beta-hydroxy steroids 11beta-hydroxysteroids an 11-beta-hydroxysteroid an 11beta-hydroxysteroid CHEBI:35346 11beta-hydroxy steroid 11beta-Hydroxysteroid KEGG_COMPOUND 11beta-Hydroxysteroid kegg.compound 11beta-hydroxy steroids ChEBI 11beta-hydroxy steroids chebi 11beta-hydroxysteroids ChEBI 11beta-hydroxysteroids chebi an 11-beta-hydroxysteroid uniprot_ft an 11beta-hydroxysteroid UniProt A sterol in which the hydroxy group at position 3 has β- configuration. CHEBI:13609 CHEBI:1725 CHEBI:1726 CHEBI:20248 chebi_ontology 3beta-hydroxysteroids 3beta-sterols CHEBI:35348 3beta-sterol 3beta-hydroxysteroids chebi 3beta-sterols chebi CHEBI:24748 CHEBI:5814 KEGG:C02159 chebi_ontology Hydroxysteroid hydroxy steroids hydroxysteroids CHEBI:35350 hydroxy steroid Hydroxysteroid KEGG_COMPOUND Hydroxysteroid kegg.compound hydroxy steroids ChEBI hydroxy steroids chebi hydroxysteroids ChEBI hydroxysteroids chebi Any heteroorganic entity containing at least one carbon-nitrogen bond. chebi_ontology organonitrogens CHEBI:35352 organonitrogen compound organonitrogens ChEBI organonitrogens chebi Any aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax. Natural fatty acids commonly have a chain of 4 to 28 carbons (usually unbranched and even-numbered), which may be saturated or unsaturated. By extension, the term is sometimes used to embrace all acyclic aliphatic carboxylic acids. CHEBI:13633 CHEBI:24024 CHEBI:4984 KEGG:C00162 Wikipedia:Fatty_acid Fatty acid chebi_ontology Fatty acid Fettsaeure Fettsaeuren acide gras acides gras acido graso acidos grasos fatty acids CHEBI:35366 fatty acid Fatty acid KEGG_COMPOUND Fatty acid kegg.compound Fettsaeure ChEBI Fettsaeure chebi Fettsaeuren ChEBI Fettsaeuren chebi acide gras ChEBI acide gras chebi acides gras ChemIDplus acides gras chemidplus acido graso ChEBI acido graso chebi acidos grasos ChEBI acidos grasos chebi fatty acids ChEBI fatty acids chebi Parent monosaccharides are polyhydroxy aldehydes H[CH(OH)]<small>_<em>n</em></small>C(=O)H or polyhydroxy ketones H‒[CHOH]<small>_<em>n</em></small>‒C(=O)[CHOH]<small>_<em>m</em></small>‒H with three or more carbon atoms. The generic term 'monosaccharide' (as opposed to oligosaccharide or polysaccharide) denotes a single unit, without glycosidic connection to other such units. It includes aldoses, dialdoses, aldoketoses, ketoses and diketoses, as well as deoxy sugars, provided that the parent compound has a (potential) carbonyl group. Parent monosaccharides are polyhydroxy aldehydes H[CH(OH)]nC(=O)H or polyhydroxy ketones H-[CHOH]n-C(=O)[CHOH]m-H with three or more carbon atoms. The generic term 'monosaccharide' (as opposed to oligosaccharide or polysaccharide) denotes a single unit, without glycosidic connection to other such units. It includes aldoses, dialdoses, aldoketoses, ketoses and diketoses, as well as deoxy sugars, provided that the parent compound has a (potential) carbonyl group. CHEBI:25407 CHEBI:6984 KEGG:C06698 Monosaccharide chebi_ontology Monosaccharid Monosaccharide Monosacharid monosacarido monosacaridos CHEBI:35381 monosaccharide Monosaccharide KEGG_COMPOUND Monosaccharid ChEBI Monosaccharid chebi Monosaccharide kegg.compound Monosacharid ChEBI Monosacharid chebi monosacarido ChEBI monosacarido chebi monosacaridos IUPAC monosacaridos iupac An α-amino-acid anion that is the conjugate base of aspartic acid. CHEBI:22659 CHEBI:29992 chebi_ontology 2-ammoniobutanedioate 2-ammoniosuccinate aspartate(1-) aspartic acid monoanion CHEBI:35391 aspartate(1-) 2-ammoniobutanedioate iupac 2-ammoniosuccinate chebi aspartate(1-) jcbn aspartic acid monoanion jcbn An oxoanion is an anion derived from an oxoacid by loss of hydron(s) bound to oxygen. CHEBI:33274 CHEBI:33436 oxoanion chebi_ontology oxoacid anions oxoanion oxoanions CHEBI:35406 oxoanion oxoanion ChEBI oxoacid anions ChEBI oxoacid anions chebi oxoanion chebi oxoanions ChEBI oxoanions chebi alpha-amino-acid residue anions CHEBI:35416 alpha-amino-acid residue anion alpha-amino-acid residue anions ChEBI A substance used in the prophylaxis or therapy of infectious diseases. chebi_ontology anti-infective agents anti-infective drugs antiinfective agents antiinfective drug CHEBI:35441 antiinfective agent anti-infective agents ChEBI anti-infective agents chebi anti-infective drugs ChEBI anti-infective drugs chebi antiinfective agents ChEBI antiinfective agents chebi antiinfective drug ChEBI antiinfective drug chebi A class of drugs producing both physiological and psychological effects through a variety of mechanisms involving the central nervous system. CNS agent CNS drugs central nervous system agents CHEBI:35470 central nervous system drug CNS agent ChEBI CNS drugs ChEBI central nervous system agents ChEBI A substance that reduces or suppresses inflammation. anti-inflammatory drugs antiinflammatory agent antiinflammatory drug antiinflammatory drugs CHEBI:35472 anti-inflammatory drug anti-inflammatory drugs ChEBI antiinflammatory agent ChEBI antiinflammatory drug ChEBI antiinflammatory drugs ChEBI chebi_ontology alkali metal salts CHEBI:35479 alkali metal salt alkali metal salts ChEBI alkali metal salts chebi An agent capable of relieving pain without the loss of consciousness or without producing anaesthesia. In addition, analgesic is a role played by a compound which is exhibited by a capability to cause a reduction of pain symptoms. chebi_ontology CHEBI:35480 analgesic A narcotic or opioid substance, synthetic or semisynthetic agent producing profound analgesia, drowsiness, and changes in mood. chebi_ontology narcotic narcotic analgesic narcotic analgesics narcotics opioid analgesics CHEBI:35482 opioid analgesic narcotic chebi narcotic analgesic chebi narcotic analgesics chebi narcotics chebi opioid analgesics chebi A loosely defined group of drugs that tend to reduce the activity of the central nervous system. CNS depressants central nervous system depressants CHEBI:35488 central nervous system depressant CNS depressants ChEBI central nervous system depressants ChEBI Compounds of structure RSSR in which R and R' are organic groups. chebi_ontology an organic disulfide organic disulfides CHEBI:35489 organic disulfide an organic disulfide uniprot_ft organic disulfides chebi An amino acid zwitterion that is the tautomer of cystine. chebi_ontology 3,3'-dithiobis(2-ammoniopropanoate) CHEBI:35492 cystine zwitterion 3,3'-dithiobis(2-ammoniopropanoate) chebi chebi_ontology alkaloid fundamental parents CHEBI:35506 alkaloid fundamental parent alkaloid fundamental parents chebi chebi_ontology CHEBI:35507 natural product fundamental parent chebi_ontology steroid fundamental parents CHEBI:35508 steroid fundamental parent steroid fundamental parents ChEBI steroid fundamental parents chebi chebi_ontology CHEBI:35509 androstane chebi_ontology CHEBI:35516 cholestane chebi_ontology CHEBI:35519 cholane An agent that selectively binds to and activates beta-adrenergic receptors. An agent that selectively binds to and activates β-adrenergic receptors. chebi_ontology beta-adrenergic agonists beta-adrenergic receptor agonist beta-adrenoceptor agonists CHEBI:35522 beta-adrenergic agonist beta-adrenergic agonists ChEBI beta-adrenergic agonists chebi beta-adrenergic receptor agonist ChEBI beta-adrenergic receptor agonist chebi beta-adrenoceptor agonists IUPHAR beta-adrenoceptor agonists iuphar An agent that causes an increase in the expansion of a bronchus or bronchial tubes. chebi_ontology bronchodilator bronchodilator agents broncholytic agent CHEBI:35523 bronchodilator agent bronchodilator ChEBI bronchodilator chebi bronchodilator agents ChEBI bronchodilator agents chebi broncholytic agent ChEBI broncholytic agent chebi A drug that mimics the effects of stimulating postganglionic adrenergic sympathetic nerves. Included in this class are drugs that directly stimulate adrenergic receptors and drugs that act indirectly by provoking the release of adrenergic transmitters. chebi_ontology sympathomimetic sympathomimetics CHEBI:35524 sympathomimetic agent sympathomimetic ChEBI sympathomimetic chebi sympathomimetics ChEBI sympathomimetics chebi chebi_ontology heterocyclic fundamental parent heterocyclic organic fundamental parents organic heterocyclic fundamental parents CHEBI:35552 heterocyclic organic fundamental parent heterocyclic fundamental parent ChEBI heterocyclic fundamental parent chebi heterocyclic organic fundamental parents ChEBI heterocyclic organic fundamental parents chebi organic heterocyclic fundamental parents ChEBI organic heterocyclic fundamental parents chebi A drug that affects the rate or intensity of cardiac contraction, blood vessel diameter or blood volume. chebi_ontology cardiovascular agent cardiovascular drugs CHEBI:35554 cardiovascular drug cardiovascular agent ChEBI cardiovascular agent chebi cardiovascular drugs ChEBI cardiovascular drugs chebi Any molecular entity that consists of a ring having (formally) the maximum number of noncumulative double bonds. chebi_ontology mancude rings mancunide-ring systems CHEBI:35568 mancude ring mancude rings ChEBI mancude rings chebi mancunide-ring systems IUPAC mancunide-ring systems iupac An agent that selectively binds to and activates alpha-adrenergic receptors. An agent that selectively binds to and activates α-adrenergic receptors. chebi_ontology alpha-adrenergic agonists alpha-adrenergic receptor agonist alpha-adrenoceptor agonists CHEBI:35569 alpha-adrenergic agonist alpha-adrenergic agonists ChEBI alpha-adrenergic agonists chebi alpha-adrenergic receptor agonist ChEBI alpha-adrenergic receptor agonist chebi alpha-adrenoceptor agonists IUPHAR alpha-adrenoceptor agonists iuphar chebi_ontology mancude organic heterobicyclic parents mancude-ring organic heterobicyclic parents CHEBI:35570 mancude organic heterobicyclic parent mancude organic heterobicyclic parents ChEBI mancude organic heterobicyclic parents chebi mancude-ring organic heterobicyclic parents ChEBI mancude-ring organic heterobicyclic parents chebi chebi_ontology mancude organic heterocyclic parents mancude-ring organic heterocyclic parents CHEBI:35571 mancude organic heterocyclic parent mancude organic heterocyclic parents ChEBI mancude organic heterocyclic parents chebi mancude-ring organic heterocyclic parents ChEBI mancude-ring organic heterocyclic parents chebi chebi_ontology organic mancude parents organic mancude-ring parents CHEBI:35573 organic mancude parent organic mancude parents ChEBI organic mancude parents chebi organic mancude-ring parents ChEBI organic mancude-ring parents chebi chebi_ontology N-oxide N-oxides CHEBI:35580 N-oxide N-oxide chebi N-oxides chebi A heterobicyclic aromatic organic compound comprising a pyrimidine ring fused to an imidazole ring; the parent compound of the purines. HMDB:HMDB0001366 KEGG:C15587 MetaCyc:PURINE chebi_ontology CHEBI:35584 purine The 1<em>H</em>-tautomer of purine. The 1H-tautomer of purine. 1H-purine chebi_ontology 1H-purine CHEBI:35586 1H-purine 1H-purine ChEBI 1H-purine chebi The 3<em>H</em>-tautomer of purine. The 3H-tautomer of purine. chebi_ontology CHEBI:35588 3H-purine The 9<em>H</em>-tautomer of purine. The 9H-tautomer of purine. Wikipedia:Purine chebi_ontology 9H-purine CHEBI:35589 9H-purine 9H-purine uniprot_ft A negative ion consisting solely of carbon and oxygen atoms, and therefore having the general formula C<small>_<em>x</em></small>O<small>_<em>y</em></small><small>^{<em>n</em>−</small>} for some integers <em>x</em>, <em>y</em> and <em>n</em>. A negative ion consisting solely of carbon and oxygen atoms, and therefore having the general formula CxOy(n-) for some integers x, y and n. carbon oxoanion chebi_ontology carbon oxoanion carbon oxoanions oxocarbon anion oxocarbon anions CHEBI:35604 carbon oxoanion carbon oxoanion ChEBI carbon oxoanion chebi carbon oxoanions ChEBI carbon oxoanions chebi oxocarbon anion ChEBI oxocarbon anion chebi oxocarbon anions ChEBI oxocarbon anions chebi chebi_ontology carbon oxoacids oxoacids of carbon CHEBI:35605 carbon oxoacid carbon oxoacids ChEBI carbon oxoacids chebi oxoacids of carbon ChEBI oxoacids of carbon chebi A substance that inhibits or prevents the proliferation of neoplasms. chebi_ontology anticancer agent anticancer agents antineoplastic antineoplastic agents cytostatic CHEBI:35610 antineoplastic agent anticancer agent chebi anticancer agents chebi antineoplastic chebi antineoplastic agents chebi cytostatic chebi A drug used to cause dilation of the blood vessels. chebi_ontology vasodilator vasodilator agents CHEBI:35620 vasodilator agent vasodilator ChEBI vasodilator chebi vasodilator agents ChEBI vasodilator agents chebi A drug used to prevent seizures or reduce their severity. Antiepileptika Antiepileptikum Antikonvulsiva Antikonvulsivum anti-convulsant anti-convulsants anti-convulsive agent anti-convulsive agents anticonvulsants anticonvulsive agent anticonvulsive agents antiepileptic antiepileptics antiepileptique antiepileptiques CHEBI:35623 anticonvulsant Antiepileptika ChEBI Antiepileptikum ChEBI Antikonvulsiva ChEBI Antikonvulsivum ChEBI anti-convulsant ChEBI anti-convulsants ChEBI anti-convulsive agent ChEBI anti-convulsive agents ChEBI anticonvulsants ChEBI anticonvulsive agent ChEBI anticonvulsive agents ChEBI antiepileptic ChEBI antiepileptics ChEBI antiepileptique ChEBI antiepileptiques ChEBI chebi_ontology CHEBI:35649 morphinan A secondary alcohol is a compound in which a hydroxy group, ‒OH, is attached to a saturated carbon atom which has two other carbon atoms attached to it. CHEBI:13425 CHEBI:13686 CHEBI:16339 CHEBI:26617 CHEBI:58662 CHEBI:8741 CHEBI:9077 chebi_ontology R-CHOH-R' Secondary alcohol a secondary alcohol secondary alcohols CHEBI:35681 secondary alcohol R-CHOH-R' kegg.compound Secondary alcohol kegg.compound a secondary alcohol uniprot_ft secondary alcohols chebi Any carboxylic acid containing two carboxy groups. CHEBI:23692 CHEBI:36172 CHEBI:4501 KEGG:C02028 Dicarboxylic acid chebi_ontology Dicarboxylic acid dicarboxylic acids CHEBI:35692 dicarboxylic acid Dicarboxylic acid KEGG_COMPOUND Dicarboxylic acid kegg.compound dicarboxylic acids ChEBI dicarboxylic acids chebi dicarboxylic acid anion chebi_ontology dicarboxylic acid anion dicarboxylic acid anions CHEBI:35693 dicarboxylic acid anion dicarboxylic acid anion ChEBI dicarboxylic acid anion chebi dicarboxylic acid anions ChEBI dicarboxylic acid anions chebi Any dicarboxylic acid anion that is a monoanion obtained by the deprotonation of only one of the carboxy groups of the dicarboxylic acid. chebi_ontology dicarboxylic acid monoanions CHEBI:35695 dicarboxylic acid monoanion dicarboxylic acid monoanions chebi A compound formally derived from an oxoacid R<small>_<em>k</em></small>E(=O)<small>_<em>l</em></small>(OH)<small>_<em>m</em></small> (<em>l</em> > 0) and an alcohol, phenol, heteroarenol, or enol by linking with formal loss of water from an acidic hydroxy group of the former and a hydroxy group of the latter. A compound formally derived from an oxoacid RkE(=O)l(OH)m (l > 0) and an alcohol, phenol, heteroarenol, or enol by linking with formal loss of water from an acidic hydroxy group of the former and a hydroxy group of the latter. CHEBI:23960 CHEBI:4859 KEGG:C00287 Wikipedia:Ester Ester chebi_ontology Ester esters CHEBI:35701 ester Ester KEGG_COMPOUND Ester kegg.compound esters ChEBI esters chebi A xenobiotic (Greek, <em>xenos</em> "foreign"; <em>bios</em> "life") is a compound that is foreign to a living organism. Principal xenobiotics include: drugs, carcinogens and various compounds that have been introduced into the environment by artificial means. CHEBI:10074 CHEBI:27333 Xenobiotic chebi_ontology Xenobiotic xenobiotic compounds CHEBI:35703 xenobiotic Xenobiotic KEGG_COMPOUND Xenobiotic kegg.compound xenobiotic compounds chebi An antimicrobial agent that destroys fungi by suppressing their ability to grow or reproduce. chebi_ontology antifungal antifungal agents antifungal drug antifungal drugs antifungals CHEBI:35718 antifungal agent antifungal ChEBI antifungal chebi antifungal agents ChEBI antifungal agents chebi antifungal drug ChEBI antifungal drug chebi antifungal drugs ChEBI antifungal drugs chebi antifungals ChEBI antifungals chebi glycosaminoglycan sulfate glycosaminoglycan sulfates sulfated glycosaminoglycans CHEBI:35722 sulfated glycosaminoglycan glycosaminoglycan sulfate ChEBI glycosaminoglycan sulfates ChEBI sulfated glycosaminoglycans ChEBI chebi_ontology carbohydrate sulfates carbohydrate sulphates CHEBI:35724 carbohydrate sulfate carbohydrate sulfates ChEBI carbohydrate sulfates chebi carbohydrate sulphates ChEBI carbohydrate sulphates chebi chebi_ontology liposaccharides CHEBI:35740 liposaccharide liposaccharides ChEBI liposaccharides chebi Any member of the group of lipids containing a common glycerol backbone to which at least one fatty acid-derived group is attached. chebi_ontology glycerolipids CHEBI:35741 glycerolipid glycerolipids chebi Any fatty acid containing a ring composed of carbon atoms. chebi_ontology carbocyclic fatty acids CHEBI:35744 carbocyclic fatty acid carbocyclic fatty acids chebi Any anion of a tricarboxylic acid formed by deprotonation of at least one carboxy group. chebi_ontology tricarboxylic acid anion tricarboxylic acid anions CHEBI:35753 tricarboxylic acid anion tricarboxylic acid anion chebi tricarboxylic acid anions chebi A carboxylic acid anion formed when the carboxy group of a monocarboxylic acid is deprotonated. CHEBI:13657 CHEBI:25382 CHEBI:3407 KEGG:C00060 chebi_ontology Carboxylate Monocarboxylate a monocarboxylate monocarboxylates monocarboxylic acid anions CHEBI:35757 monocarboxylic acid anion Carboxylate KEGG_COMPOUND Carboxylate kegg.compound Monocarboxylate KEGG_COMPOUND Monocarboxylate kegg.compound a monocarboxylate UniProt a monocarboxylate uniprot_ft monocarboxylates ChEBI monocarboxylates chebi monocarboxylic acid anions ChEBI monocarboxylic acid anions chebi A phosphorus oxoanion that is the conjugate base of phosphoric acid. chebi_ontology Pi phosphate phosphate ions CHEBI:35780 phosphate ion Pi ChEBI Pi chebi phosphate ChEBI phosphate chebi phosphate ions ChEBI phosphate ions chebi Sphinganine, its homologs and stereoisomers, and the hydroxy and unsaturated derivatives of these compounds. chebi_ontology Spd sphingoid sphingoid base sphingoid bases sphingoids CHEBI:35785 sphingoid Spd iubmb sphingoid iubmb sphingoid base iubmb sphingoid bases lipidmaps sphingoids chebi chebi_ontology phosphosphingolipids sphingophospholipid sphingophospholipids CHEBI:35786 phosphosphingolipid phosphosphingolipids ChEBI phosphosphingolipids chebi sphingophospholipid ChEBI sphingophospholipid chebi sphingophospholipids ChEBI sphingophospholipids chebi chebi_ontology seco-steroids CHEBI:35788 seco-steroid seco-steroids chebi CHEBI:24979 CHEBI:25804 chebi_ontology keto steroids ketosteroids oxo steroids oxosteroids CHEBI:35789 oxo steroid keto steroids ChEBI keto steroids chebi ketosteroids ChEBI ketosteroids chebi oxo steroids ChEBI oxo steroids chebi oxosteroids ChEBI oxosteroids chebi chebi_ontology tetrapyrrole fundamental parents CHEBI:35794 tetrapyrrole fundamental parent tetrapyrrole fundamental parents ChEBI tetrapyrrole fundamental parents chebi A tricarboxylic acid monoanion that is the conjugate base of citric acid, obtained by deprotonation of one of the three carboxy groups. chebi_ontology H2cit H2cit(-) CHEBI:35804 citrate(1-) H2cit iupac H2cit(-) chebi A tricarboxylic acid dianion obtained by deprotonation of two of the three carboxy groups of citric acid. chebi_ontology Hcit Hcit(2-) CHEBI:35808 citrate(2-) Hcit iupac Hcit(2-) chebi Any monocarboxylic acid which also contains a separate (alcoholic or phenolic) hydroxy substituent. chebi_ontology hydroxy acid hydroxy monocarboxylic acids CHEBI:35868 hydroxy monocarboxylic acid hydroxy acid chebi hydroxy monocarboxylic acids chebi chebi_ontology imidazopyrimidines CHEBI:35875 imidazopyrimidine imidazopyrimidines ChEBI imidazopyrimidines chebi pnictogen hydride chebi_ontology pnictogen hydride pnictogen hydrides CHEBI:35881 pnictogen hydride pnictogen hydride ChEBI pnictogen hydride chebi pnictogen hydrides ChEBI pnictogen hydrides chebi Any carboxylic acid anion containing at least one oxo group. oxo carboxylic acid anions CHEBI:35903 oxo carboxylic acid anion oxo carboxylic acid anions ChEBI A dicarboxylic acid monoanion that is the conjugate base of glutaric acid. CHEBI:30922 CHEBI:35906 chebi_ontology hydrogen glutarate CHEBI:35907 glutarate(1-) hydrogen glutarate chebi A monosubstitution product of hydrogen peroxide, HOOH. chebi_ontology hydroperoxide hydroperoxides CHEBI:35923 hydroperoxide hydroperoxide chebi hydroperoxides chebi Monosubstitution products of hydrogen peroxide HOOH, having the skeleton ROOH, in which R is any organyl group. chebi_ontology a hydroperoxide hydroperoxides organic hydroperoxides peroxols CHEBI:35924 peroxol a hydroperoxide uniprot_ft hydroperoxides iupac organic hydroperoxides chebi peroxols chebi A substance used for its pharmacological action on any aspect of neurotransmitter systems. Neurotransmitter agents include agonists, antagonists, degradation inhibitors, uptake inhibitors, depleters, precursors, and modulators of receptor function. chebi_ontology neurotransmitter agents CHEBI:35942 neurotransmitter agent neurotransmitter agents ChEBI neurotransmitter agents chebi A hydroxy monocarboxylic acid that has a hydroxy group β to the carboxy group. chebi_ontology 3-hydroxy acid 3-hydroxy monocarboxylic acids beta-hydroxy acid beta-hydroxy acids beta-hydroxy carboxylic acid beta-hydroxy carboxylic acids CHEBI:35969 3-hydroxy monocarboxylic acid 3-hydroxy acid chebi 3-hydroxy monocarboxylic acids chebi beta-hydroxy acid chebi beta-hydroxy acids chebi beta-hydroxy carboxylic acid chebi beta-hydroxy carboxylic acids chebi Any amino acid carrying two amino groups. chebi_ontology CHEBI:35987 diamino acid A family of polyunsaturated fatty acids that have in common a final carbon-carbon double bond in the n-6 position, i.e., the sixth bond from the methyl end of the fatty acid. chebi_ontology omega-6 fatty acid omega-6 fatty acids CHEBI:36009 omega-6 fatty acid omega-6 fatty acid chebi omega-6 fatty acids chebi A 20-carbon, polyunsaturated fatty acid having four double bonds at unspecified positions. chebi_ontology 20:4 C20:4 eicosatetraenoic acid eicosatetraenoic acids icosatetraenoic acid icosatetraenoic acids CHEBI:36033 icosatetraenoic acid 20:4 chebi C20:4 chebi eicosatetraenoic acid chebi eicosatetraenoic acids chebi icosatetraenoic acid chebi icosatetraenoic acids chebi Any monocarboxylic acid anion carrying at least one hydroxy substituent. chebi_ontology hydroxy monocarboxylic acid anions hydroxymonocarboxylic acid anion hydroxymonocarboxylic acid anions CHEBI:36059 hydroxy monocarboxylic acid anion hydroxy monocarboxylic acid anions chebi hydroxymonocarboxylic acid anion chebi hydroxymonocarboxylic acid anions chebi CHEBI:22867 CHEBI:50419 chebi_ontology bile acids and derivatives cholanoids CHEBI:36078 cholanoid bile acids and derivatives LIPID_MAPS bile acids and derivatives lipidmaps cholanoids ChEBI cholanoids chebi A biological macromolecule minimally consisting of one polypeptide chain synthesized at the ribosome. CHEBI:13677 CHEBI:14911 chebi_ontology CHEBI:36080 protein Any dicarboxylic acid carrying one or more oxo groups. oxo dicarboxylic acids CHEBI:36145 oxo dicarboxylic acid oxo dicarboxylic acids ChEBI bile acid anions CHEBI:36235 bile acid anion bile acid anions ChEBI A steroid acid that consists of cholane having a carboxy group in place of the methyl group at position 24. Patent:JP2008069152 CHEBI:36237 cholanic acid 5beta-cholanic acid (5beta)-cholan-24-oic acid (5beta,17beta)-gamma-methylandrostane-17-butanoic acid 5beta-cholanoic acid ursocholanic acid CHEBI:36238 5beta-cholanic acid 5beta-cholanic acid ChemIDplus (5beta)-cholan-24-oic acid ChemIDplus (5beta,17beta)-gamma-methylandrostane-17-butanoic acid ChemIDplus 5beta-cholanoic acid ChemIDplus ursocholanic acid ChemIDplus Members of the class of cholanic acids based on a 5beta-cholane skeleton. CHEBI:36248 5beta-cholanic acids A salt of a bile acid. bile acid salts CHEBI:36277 bile acid salt bile acid salts ChEBI CHEBI:23166 CHEBI:23211 CHEBI:36278 cholanic acids chebi_ontology tricarboxylic acid monoanions CHEBI:36299 tricarboxylic acid monoanion tricarboxylic acid monoanions chebi chebi_ontology tricarboxylic acid dianions CHEBI:36300 tricarboxylic acid dianion tricarboxylic acid dianions chebi Any icosatetraenoic acid with the double bonds at positions 5, 8, 11 and 14. chebi_ontology 5,8,11,14-20:4 5,8,11,14-eicosatetraenoic acid 5,8,11,14-eicosatetraenoic acids 5,8,11,14-icosatetraenoic acid 5,8,11,14-icosatetraenoic acids C20:4, n-6,9,12,15 eicosa-5,8,11,14-tetraenoic acid eicosa-5,8,11,14-tetraenoic acids icosa-5,8,11,14-tetraenoic acids CHEBI:36306 icosa-5,8,11,14-tetraenoic acid 5,8,11,14-20:4 chebi 5,8,11,14-eicosatetraenoic acid chebi 5,8,11,14-eicosatetraenoic acids chebi 5,8,11,14-icosatetraenoic acid chebi 5,8,11,14-icosatetraenoic acids chebi C20:4, n-6,9,12,15 chebi eicosa-5,8,11,14-tetraenoic acid chebi eicosa-5,8,11,14-tetraenoic acids chebi icosa-5,8,11,14-tetraenoic acids chebi chebi_ontology cyclic tetrapyrroles macrocyclic tetrapyrrole CHEBI:36309 cyclic tetrapyrrole cyclic tetrapyrroles ChEBI cyclic tetrapyrroles chebi macrocyclic tetrapyrrole ChEBI macrocyclic tetrapyrrole chebi The glycerol phosphate ester of a phosphocholine. A nutrient with many different roles in human health. CHEBI:26698 CHEBI:35763 chebi_ontology glycerophosphocholines CHEBI:36313 glycerophosphocholine glycerophosphocholines chebi Lepton is a fermion that does not experience the strong force (strong interaction). The term is derived from the Greek lambdaepsilonpitauomicronsigma (small, thin). Lepton is a fermion that does not experience the strong force (strong interaction). The term is derived from the Greek λεπτοσ (small, thin). chebi_ontology leptons CHEBI:36338 lepton leptons ChEBI leptons chebi Baryon is a fermion that does experience the strong force (strong interaction). The term is derived from the Greek betaalpharhoupsilonsigma (heavy). Baryon is a fermion that does experience the strong force (strong interaction). The term is derived from the Greek βαρυσ (heavy). chebi_ontology baryons CHEBI:36339 baryon baryons ChEBI baryons chebi Particle of half-integer spin quantum number following Fermi-Dirac statistics. Fermions are named after Enrico Fermi. chebi_ontology fermions CHEBI:36340 fermion fermions ChEBI fermions chebi Particle of integer spin quantum number following Bose-Einstein statistics. Bosons are named after Satyendra Nath Bose. bosons CHEBI:36341 boson bosons ChEBI A particle smaller than an atom. Wikipedia:Subatomic_particle chebi_ontology subatomic particles CHEBI:36342 subatomic particle subatomic particles ChEBI subatomic particles chebi A subatomic particle known to have substructure (i.e. consisting of smaller particles). chebi_ontology composite particles CHEBI:36343 composite particle composite particles ChEBI composite particles chebi Hadron is a subatomic particle which experiences the strong force. chebi_ontology hadrons CHEBI:36344 hadron hadrons ChEBI hadrons chebi A nucleus or any of its constituents in any of their energy states. chebi_ontology CHEBI:36347 nuclear particle Any molecular entity consisting of more than one atom. chebi_ontology polyatomic entities CHEBI:36357 polyatomic entity polyatomic entities ChEBI polyatomic entities chebi An ion consisting of more than one atom. chebi_ontology polyatomic ions CHEBI:36358 polyatomic ion polyatomic ions ChEBI polyatomic ions chebi phosphorus oxoacid derivative chebi_ontology phosphorus oxoacid derivative CHEBI:36359 phosphorus oxoacid derivative phosphorus oxoacid derivative ChEBI phosphorus oxoacid derivative chebi chebi_ontology phosphorus oxoacids and derivatives CHEBI:36360 phosphorus oxoacids and derivatives phosphorus oxoacids and derivatives chebi alkaline earth salts CHEBI:36364 alkaline earth salt alkaline earth salts ChEBI chebi_ontology sulfoglycosphingolipids CHEBI:36477 sulfoglycosphingolipid sulfoglycosphingolipids chebi Any of the cerebrosides in which the monosaccharide head group is galactose. CHEBI:13641 KEGG:C02686 KEGG:G11121 Cerebroside D-Galactosyl-N-acylsphingosine D-Galactosylceramide Galactocerebroside a D-galactosylceramide galactocerebroside galactocerebrosides galactosylceramides CHEBI:36498 galactosylceramide Cerebroside KEGG_COMPOUND D-Galactosyl-N-acylsphingosine KEGG_COMPOUND D-Galactosylceramide KEGG_COMPOUND Galactocerebroside KEGG_COMPOUND a D-galactosylceramide UniProt galactocerebroside ChEBI galactocerebrosides ChEBI galactosylceramides ChEBI CHEBI:22208 CHEBI:2428 chebi_ontology Acidic glycosphingolipid acidic glycosphingolipids CHEBI:36526 acidic glycosphingolipid Acidic glycosphingolipid kegg.compound acidic glycosphingolipids chebi Any compound containing the carbonyl group, C=O. The term is commonly used in the restricted sense of aldehydes and ketones, although it actually includes carboxylic acids and derivatives. chebi_ontology CHEBI:36586 carbonyl compound Organic compounds containing an oxygen atom, =O, doubly bonded to carbon or another element. chebi_ontology organic oxo compounds CHEBI:36587 organic oxo compound organic oxo compounds ChEBI organic oxo compounds chebi Any of a class of steroid hormones that are produced in the adrenal cortex. chebi_ontology adrenal cortex hormones corticosteroid hormones CHEBI:36699 corticosteroid hormone adrenal cortex hormones ChEBI adrenal cortex hormones chebi corticosteroid hormones ChEBI corticosteroid hormones chebi Any compound having phosphocholine as part of its structure. chebi_ontology O-phosphocholines choline phosphates phosphorylcholines CHEBI:36700 phosphocholines O-phosphocholines ChEBI O-phosphocholines chebi choline phosphates ChEBI choline phosphates chebi phosphorylcholines ChEBI phosphorylcholines chebi Compounds based on a biladiene skeleton. chebi_ontology CHEBI:36735 biladienes chebi_ontology monoanions CHEBI:36830 monoanion monoanions chebi Any hydroxy steroid carrying a hydroxy group at position 3. chebi_ontology 3-hydroxy steroids CHEBI:36834 3-hydroxy steroid 3-hydroxy steroids chebi A 3-hydroxy steroid in which the 3-hydroxy substituent is in the β-position. CHEBI:71195 chebi_ontology 3beta-hydroxy steroids a 3beta-hydroxysteroid CHEBI:36836 3beta-hydroxy steroid 3beta-hydroxy steroids chebi a 3beta-hydroxysteroid uniprot_ft A hydroxy steroid carrying a hydroxy group at position 17. chebi_ontology 17-hydroxy steroids CHEBI:36838 17-hydroxy steroid 17-hydroxy steroids ChEBI 17-hydroxy steroids chebi chebi_ontology 11-hydroxy steroids CHEBI:36841 11-hydroxy steroid 11-hydroxy steroids ChEBI 11-hydroxy steroids chebi chebi_ontology hydroxy seco-steroids CHEBI:36853 hydroxy seco-steroid hydroxy seco-steroids chebi An oxo steroid carrying an oxo group at position 20. chebi_ontology 20-oxo steroids CHEBI:36885 20-oxo steroid 20-oxo steroids ChEBI 20-oxo steroids chebi chebi_ontology 18-oxo steroids CHEBI:36887 18-oxo steroid 18-oxo steroids ChEBI 18-oxo steroids chebi chalcogen hydride chebi_ontology chalcogen hydride chalcogen hydrides CHEBI:36902 chalcogen hydride chalcogen hydride ChEBI chalcogen hydride chebi chalcogen hydrides ChEBI chalcogen hydrides chebi chebi_ontology inorganic ions CHEBI:36914 inorganic ion inorganic ions ChEBI inorganic ions chebi chebi_ontology inorganic cations CHEBI:36915 inorganic cation inorganic cations ChEBI inorganic cations chebi A monoatomic or polyatomic species having one or more elementary charges of the proton. CHEBI:23058 CHEBI:3473 KEGG:C01373 Cation chebi_ontology Cation Kation Kationen cation cationes cations CHEBI:36916 cation Cation KEGG_COMPOUND Cation kegg.compound Kation ChEBI Kation chebi Kationen ChEBI Kationen chebi cation chebi cationes ChEBI cationes chebi cations ChEBI cations chebi chalcocarbonic acid chebi_ontology chalcocarbonic acid chalcocarbonic acids CHEBI:36961 chalcocarbonic acid chalcocarbonic acid ChEBI chalcocarbonic acid chebi chalcocarbonic acids ChEBI chalcocarbonic acids chebi An organochalcogen compound is a compound containing at least one carbon-chalcogen bond. organochalcogen compound chebi_ontology organochalcogen compound organochalcogen compounds CHEBI:36962 organochalcogen compound organochalcogen compound ChEBI organochalcogen compound chebi organochalcogen compounds ChEBI organochalcogen compounds chebi An organochalcogen compound containing at least one carbon-oxygen bond. organooxygen compound chebi_ontology organooxygen compound organooxygen compounds CHEBI:36963 organooxygen compound organooxygen compound ChEBI organooxygen compound chebi organooxygen compounds ChEBI organooxygen compounds chebi A nucleotide is a nucleoside phosphate resulting from the condensation of the 3 or 5 hydroxy group of a nucleoside with phosphoric acid. CHEBI:13215 CHEBI:13663 CHEBI:7656 KEGG:C00215 Wikipedia:Nucleotide Nucleotide chebi_ontology Nucleotide nucleotides CHEBI:36976 nucleotide Nucleotide KEGG_COMPOUND Nucleotide kegg.compound nucleotides ChEBI nucleotides chebi chebi_ontology ribonucleoside 5'-phosphates CHEBI:37015 ribonucleoside 5'-phosphate ribonucleoside 5'-phosphates ChEBI ribonucleoside 5'-phosphates chebi chebi_ontology amino acid anion amino acid anions amino-acid anions CHEBI:37022 amino-acid anion amino acid anion ChEBI amino acid anion chebi amino acid anions ChEBI amino acid anions chebi amino-acid anions ChEBI amino-acid anions chebi chebi_ontology purine ribonucleoside 5'-diphosphates CHEBI:37038 purine ribonucleoside 5'-diphosphate purine ribonucleoside 5'-diphosphates ChEBI purine ribonucleoside 5'-diphosphates chebi chebi_ontology purine ribonucleoside 5'-triphosphates CHEBI:37045 purine ribonucleoside 5'-triphosphate purine ribonucleoside 5'-triphosphates ChEBI purine ribonucleoside 5'-triphosphates chebi chebi_ontology ribonucleoside 5'-diphosphates CHEBI:37075 ribonucleoside 5'-diphosphate ribonucleoside 5'-diphosphates ChEBI ribonucleoside 5'-diphosphates chebi chebi_ontology ribonucleoside 5'-triphosphates CHEBI:37076 ribonucleoside 5'-triphosphate ribonucleoside 5'-triphosphates ChEBI ribonucleoside 5'-triphosphates chebi chebi_ontology adenosine 5'-phosphates CHEBI:37096 adenosine 5'-phosphate adenosine 5'-phosphates ChEBI adenosine 5'-phosphates chebi An organoiodine compound is a compound containing at least one carbon-iodine bond. chebi_ontology organoiodine compound organoiodine compounds CHEBI:37142 organoiodine compound organoiodine compound chebi organoiodine compounds chebi A polysaccharide composed of glucose residues. CHEBI:24255 CHEBI:5392 KEGG:C01379 Glucan chebi_ontology Glucan glucans CHEBI:37163 glucan Glucan KEGG_COMPOUND Glucan kegg.compound glucans ChEBI glucans chebi Glycans composed of a single type of monosaccharide residue. They are named by replacing the ending '-ose' of the sugar by '-an'. chebi_ontology homoglycan homopolysaccharides CHEBI:37164 homopolysaccharide homoglycan IUPAC homoglycan iupac homopolysaccharides ChEBI homopolysaccharides chebi chebi_ontology organic hydrides CHEBI:37175 organic hydride organic hydrides ChEBI organic hydrides chebi chebi_ontology mononuclear hydride mononuclear hydrides CHEBI:37176 mononuclear parent hydride mononuclear hydride ChEBI mononuclear hydride chebi mononuclear hydrides IUPAC mononuclear hydrides iupac chebi_ontology CHEBI:37246 elemental sodium CHEBI:37247 elemental potassium Any of the group of polysaccharides composed of alternating units from uronic acids and glycosamines, and commonly partially esterified with sulfuric acid. CHEBI:25425 CHEBI:7011 KEGG:C05114 Mucopolysaccharide chebi_ontology Mucopolysaccharid Mucopolysaccharide Mukopolysaccharid mucopolisacarido mucopolisacaridos CHEBI:37395 mucopolysaccharide Mucopolysaccharide KEGG_COMPOUND Mucopolysaccharid ChEBI Mucopolysaccharid chebi Mucopolysaccharide kegg.compound Mukopolysaccharid ChEBI Mukopolysaccharid chebi mucopolisacarido ChEBI mucopolisacarido chebi mucopolisacaridos IUPAC mucopolisacaridos iupac Any of a class of 10--60 kDa glycosaminoglycan sulfates, widely distributed in cartilage and other mammalian connective tissues. CHEBI:23224 CHEBI:3676 KEGG:C00607 Chondroitin sulfate Chondroitinsulfat chondroitin polysulfate chondroitin sulfates chondroitin sulfuric acid chondroitin sulphate CHEBI:37397 chondroitin sulfate Chondroitin sulfate KEGG_COMPOUND Chondroitinsulfat ChEBI chondroitin polysulfate ChemIDplus chondroitin sulfates ChemIDplus chondroitin sulfuric acid ChemIDplus chondroitin sulphate ChemIDplus chebi_ontology CHEBI:37404 elemental copper A group of heterocyclic compounds based on the pteroic acid skeleton conjugated with one or more <small>L</small>-glutamic acid units. CHEBI:24074 CHEBI:24076 chebi_ontology folate folates CHEBI:37445 folic acids folate chebi folates chebi An acid is a molecular entity capable of donating a hydron (Bronsted acid) or capable of forming a covalent bond with an electron pair (Lewis acid). An acid is a molecular entity capable of donating a hydron (Brønsted acid) or capable of forming a covalent bond with an electron pair (Lewis acid). CHEBI:13800 CHEBI:13801 CHEBI:22209 CHEBI:2426 KEGG:C00174 Acid chebi_ontology Acid Saeure Saeuren acide acido acids CHEBI:37527 acid Acid KEGG_COMPOUND Acid kegg.compound Saeure ChEBI Saeure chebi Saeuren ChEBI Saeuren chebi acide IUPAC acide iupac acido ChEBI acido chebi acids ChEBI acids chebi A molecular entity consisting of two or more chemical elements. chebi_ontology chemical compound heteroatomic molecular entities CHEBI:37577 heteroatomic molecular entity chemical compound ChEBI chemical compound chebi heteroatomic molecular entities ChEBI heteroatomic molecular entities chebi Any heteroatomic molecular entity that is a chemical compound of halogen with other chemical elements. chebi_ontology halides CHEBI:37578 halide halides chebi A lactone having a five-membered lactone ring. CHEBI:13194 CHEBI:18937 CHEBI:22971 CHEBI:541 chebi_ontology 1,4-Lactone 1,4-lactones a 1,4-lactone butyrolactones gamma-Laktone gamma-lactona gamma-lactonas gamma-lactones CHEBI:37581 gamma-lactone 1,4-Lactone kegg.compound 1,4-lactones chebi a 1,4-lactone uniprot_ft butyrolactones chebi gamma-Laktone chebi gamma-lactona chebi gamma-lactonas chebi gamma-lactones chebi An amide of a carboxylic acid, having the structure RC(=O)NR2. The term is used as a suffix in systematic name formation to denote the -C(=O)NH2 group including its carbon atom. An amide of a carboxylic acid, having the structure RC(=O)NR<small>₂</small>. The term is used as a suffix in systematic name formation to denote the ‒C(=O)NH<small>₂</small> group including its carbon atom. CHEBI:35354 CHEBI:35355 chebi_ontology carboxamides primary carboxamide CHEBI:37622 carboxamide carboxamides ChEBI carboxamides chebi primary carboxamide ChEBI primary carboxamide chebi CHEBI:37661 glucopyranose CHEBI:26019 chebi_ontology phosphate esters phosphoric esters CHEBI:37734 phosphoric ester phosphate esters chebi phosphoric esters chebi Any glycerolipid having a phosphate group ester-linked to a terminal carbon of the glycerol backbone. CHEBI:24362 CHEBI:5456 chebi_ontology glycerophospholipids phosphatide phosphatides phosphoglyceride phosphoglycerides CHEBI:37739 glycerophospholipid glycerophospholipids chebi phosphatide chebi phosphatides chebi phosphoglyceride chebi phosphoglycerides chebi A non-proteinogenic L-alpha-amino acid that is L-tyrosine phosphorylated at the phenolic hydroxy group. CHEBI:21991 CHEBI:45080 CHEBI:45158 CHEBI:45187 CHEBI:45209 CHEBI:8171 DrugBank:DB01962 KEGG:C06501 PDBeChem:PTR O-phospho-L-tyrosine O-phosphono-L-tyrosine O-phosphotyrosine Phosphonotyrosine Phosphotyrosine tyrosine phosphate CHEBI:37788 O(4)-phospho-L-tyrosine O-phospho-L-tyrosine ChEBI O-phosphono-L-tyrosine ChEBI O-phosphotyrosine ChEBI Phosphonotyrosine KEGG_COMPOUND Phosphotyrosine KEGG_COMPOUND tyrosine phosphate ChEBI An organosulfonic acid containing one or more amino groups. chebi_ontology amino sulfonic acids aminosulfonic acid aminosulfonic acids CHEBI:37793 amino sulfonic acid amino sulfonic acids chebi aminosulfonic acid chebi aminosulfonic acids chebi A straight chain alkane composed of 4 carbon atoms. CHEBI:22945 CHEBI:25462 CHEBI:44430 chebi_ontology E 943a E-943a E943a N-BUTANE R-600 butane n-Butan n-C4H10 n-butane CHEBI:37808 butane E 943a chebi E-943a chebi E943a chebi N-BUTANE pdb-ccd R-600 chebi butane uniprot_ft n-Butan chebi n-C4H10 nist n-butane nist sulfuric acid derivative chebi_ontology sulfuric acid derivative sulfuric acid derivatives CHEBI:37826 sulfuric acid derivative sulfuric acid derivative ChEBI sulfuric acid derivative chebi sulfuric acid derivatives ChEBI sulfuric acid derivatives chebi chebi_ontology CHEBI:37834 (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraene Acyclic branched or unbranched hydrocarbons having four carbon-carbon double bonds. chebi_ontology alkatetraenes CHEBI:37835 alkatetraene alkatetraenes chebi A carboacyl group is a group formed by loss of at least one OH from the carboxy group of a carboxylic acid. chebi_ontology carboxylic acyl groups CHEBI:37838 carboacyl group carboxylic acyl groups IUPAC carboxylic acyl groups iupac A hormone that specifically regulates growth. chebi_ontology GH Somatotropin Wachstumshormon growth hormones CHEBI:37845 growth hormone GH kegg.compound Somatotropin kegg.compound Wachstumshormon chebi growth hormones chebi chebi_ontology chalcoperoxol chalcoperoxols organic chalcohydroperoxide CHEBI:37863 chalcoperoxol chalcoperoxol chebi chalcoperoxols chebi organic chalcohydroperoxide chebi An agent that selectively binds to and activates adrenergic receptors. chebi_ontology adrenergic agonists adrenergic receptor agonist adrenoceptor agonists adrenomimetic adrenomimetics CHEBI:37886 adrenergic agonist adrenergic agonists ChEBI adrenergic agonists chebi adrenergic receptor agonist ChEBI adrenergic receptor agonist chebi adrenoceptor agonists IUPHAR adrenoceptor agonists iuphar adrenomimetic ChEBI adrenomimetic chebi adrenomimetics ChEBI adrenomimetics chebi Any agent that acts on an adrenergic receptor or affects the life cycle of an adrenergic transmitter. chebi_ontology adrenergic agents adrenergic drug adrenergic drugs adrenergic neuron agents adrenergics CHEBI:37962 adrenergic agent adrenergic agents ChEBI adrenergic agents chebi adrenergic drug ChEBI adrenergic drug chebi adrenergic drugs ChEBI adrenergic drugs chebi adrenergic neuron agents ChEBI adrenergic neuron agents chebi adrenergics ChEBI adrenergics chebi A drug used for the treatment or prevention of cardiac arrhythmias. Anti-arrhythmia drugs may affect the polarisation-repolarisation phase of the action potential, its excitability or refractoriness, or impulse conduction or membrane responsiveness within cardiac fibres. chebi_ontology anti-arrhythmia agent antiarrhythmic agent CHEBI:38070 anti-arrhythmia drug anti-arrhythmia agent ChEBI anti-arrhythmia agent chebi antiarrhythmic agent ChEBI antiarrhythmic agent chebi A compound composed of two or more pyrrole units. chebi_ontology PPys poly(pyrrole)s polypyrroles CHEBI:38077 polypyrrole PPys ChEBI PPys chebi poly(pyrrole)s ChEBI poly(pyrrole)s chebi polypyrroles ChEBI polypyrroles chebi Any organonitrogen compound containing a cyclic component with nitrogen and at least one other element as ring member atoms. chebi_ontology heterocyclic organonitrogen compounds organonitrogen heterocyclic compounds CHEBI:38101 organonitrogen heterocyclic compound heterocyclic organonitrogen compounds ChEBI heterocyclic organonitrogen compounds chebi organonitrogen heterocyclic compounds ChEBI organonitrogen heterocyclic compounds chebi Any organic heterocyclic compound containing at least one ring oxygen atom. chebi_ontology heterocyclic organooxygen compounds organooxygen heterocyclic compounds oxacycles CHEBI:38104 oxacycle heterocyclic organooxygen compounds ChEBI heterocyclic organooxygen compounds chebi organooxygen heterocyclic compounds ChEBI organooxygen heterocyclic compounds chebi oxacycles ChEBI oxacycles chebi chebi_ontology heterocyclic organosulfur compounds organosulfur heterocyclic compounds CHEBI:38106 organosulfur heterocyclic compound heterocyclic organosulfur compounds chebi organosulfur heterocyclic compounds chebi Any aldehyde with two aldehyde groups. chebi_ontology bialdehyde bialdehydes dialdehydes CHEBI:38124 dialdehyde bialdehyde chebi bialdehydes chebi dialdehydes chebi A drug that has a strengthening effect on the heart or that can increase cardiac output. chebi_ontology cardiotonic drugs CHEBI:38147 cardiotonic drug cardiotonic drugs ChEBI cardiotonic drugs chebi A ligand with two or more separate binding sites that can bind to a single metallic central atom, forming a chelate. CHEBI:23090 CHEBI:3585 CHEBI:6789 chebi_ontology Chelating agent Metal chelator chelating agents chelators complexon CHEBI:38161 chelator Chelating agent kegg.compound Metal chelator kegg.compound chelating agents chebi chelators chebi complexon chebi chebi_ontology organic heteropentacyclic compounds CHEBI:38164 organic heteropentacyclic compound organic heteropentacyclic compounds chebi CHEBI:25429 CHEBI:38075 chebi_ontology organic heteropolycyclic compounds CHEBI:38166 organic heteropolycyclic compound organic heteropolycyclic compounds ChEBI organic heteropolycyclic compounds chebi chebi_ontology monocyclic heteroarenes CHEBI:38179 monocyclic heteroarene monocyclic heteroarenes ChEBI monocyclic heteroarenes chebi chebi_ontology polycyclic heteroarenes CHEBI:38180 polycyclic heteroarene polycyclic heteroarenes ChEBI polycyclic heteroarenes chebi chebi_ontology hydrocarbyl anion hydrocarbyl anions CHEBI:38222 hydrocarbyl anion hydrocarbyl anion chebi hydrocarbyl anions chebi Any of a class of heterocyclic amines having a saturated five-membered ring. CHEBI:26922 CHEBI:38191 chebi_ontology CHEBI:38260 pyrrolidines chebi_ontology CHEBI:38261 imidazolidines An α-amino acid that is butanoic acid substituted by an amino group at position 2 and a hydroxy group at position 3. chebi_ontology CHEBI:38263 2-amino-3-hydroxybutanoic acid A branched chain amino acid that consists of 3-methylpentanoic acid bearing an amino substituent at position 2. chebi_ontology CHEBI:38264 2-amino-3-methylpentanoic acid The <small>L</small>-enantiomer of ascorbate and conjugate base of <small>L</small>-ascorbic acid, arising from selective deprotonation of the 3-hydroxy group. Required for a range of essential metabolic reactions in all animals and plants. CHEBI:13082 CHEBI:13861 chebi_ontology Ascorbate L-Ascorbate L-ascorbate L-ascorbate(1-) L-ascorbic acid, ion(1-) Vitamin C CHEBI:38290 L-ascorbate Ascorbate kegg.compound L-Ascorbate kegg.compound L-ascorbate uniprot_ft L-ascorbate(1-) chebi L-ascorbic acid, ion(1-) chemidplus Vitamin C kegg.compound chebi_ontology diazolidines CHEBI:38304 diazolidine diazolidines chebi Any organic heterocyclic compound containing a benzene ring in which two of the C-H fragments have been replaced by isolobal nitrogens (the diazine parent structure). chebi_ontology CHEBI:38313 diazines chebi_ontology pyrimidinecarboxylate anions CHEBI:38316 pyrimidinecarboxylate anion pyrimidinecarboxylate anions chebi Any drug used for its actions on cholinergic systems. Included here are agonists and antagonists, drugs that affect the life cycle of acetylcholine, and drugs that affect the survival of cholinergic neurons. chebi_ontology cholinergic agent cholinergic drugs cholinomimetic CHEBI:38323 cholinergic drug cholinergic agent ChEBI cholinergic agent chebi cholinergic drugs ChEBI cholinergic drugs chebi cholinomimetic ChEBI cholinomimetic chebi Any drug that binds to and activates cholinergic receptors. chebi_ontology acetylcholine agonist acetylcholine agonists acetylcholine receptor agonist cholinergic agonists cholinomimetic cholinomimetics CHEBI:38324 cholinergic agonist acetylcholine agonist ChEBI acetylcholine agonist chebi acetylcholine agonists ChEBI acetylcholine agonists chebi acetylcholine receptor agonist IUPHAR acetylcholine receptor agonist iuphar cholinergic agonists ChEBI cholinergic agonists chebi cholinomimetic ChEBI cholinomimetic chebi cholinomimetics ChEBI cholinomimetics chebi Any drug that binds to and activates a muscarinic cholinergic receptor. chebi_ontology muscarinic acetylcholine receptor agonist muscarinic agonists muscarinic cholinergic agonist muscarinic cholinergic agonists CHEBI:38325 muscarinic agonist muscarinic acetylcholine receptor agonist ChEBI muscarinic acetylcholine receptor agonist chebi muscarinic agonists ChEBI muscarinic agonists chebi muscarinic cholinergic agonist ChEBI muscarinic cholinergic agonist chebi muscarinic cholinergic agonists ChEBI muscarinic cholinergic agonists chebi A pyrimidine carrying one or more oxo substituents. chebi_ontology pyrimidones CHEBI:38337 pyrimidone pyrimidones chebi A member of the class of pyrimidines that is pyrimidine substituted by at least one amino group and its derivatives. chebi_ontology aminopyrimidines CHEBI:38338 aminopyrimidine aminopyrimidines chebi CHEBI:26949 CHEBI:38417 chebi_ontology 1,3-thiazoles CHEBI:38418 1,3-thiazoles 1,3-thiazoles chebi chebi_ontology 1-benzopyrans CHEBI:38443 1-benzopyran 1-benzopyrans chebi chebi_ontology ETC inhibitor electron transport chain inhibitors CHEBI:38496 electron-transport chain inhibitor ETC inhibitor chebi electron transport chain inhibitors chebi chebi_ontology respiratory chain inhibitor respiratory electron-transport chain inhibitor respiratory-chain inhibitors CHEBI:38497 respiratory-chain inhibitor respiratory chain inhibitor chebi respiratory electron-transport chain inhibitor chebi respiratory-chain inhibitors chebi chebi_ontology isoquinoline alkaloid fundamental parents CHEBI:38515 isoquinoline alkaloid fundamental parent isoquinoline alkaloid fundamental parents chebi chebi_ontology simple proteins CHEBI:38560 simple protein simple proteins ChEBI simple proteins chebi CHEBI:22503 CHEBI:24792 chebi_ontology aminoalkylindoles CHEBI:38631 aminoalkylindole aminoalkylindoles ChEBI aminoalkylindoles chebi organic sodium salt chebi_ontology organic sodium salt organic sodium salts CHEBI:38700 organic sodium salt organic sodium salt ChEBI organic sodium salt chebi organic sodium salts ChEBI organic sodium salts chebi Any dianion containing at least one carboxy group. carboxylic acid dianion chebi_ontology carboxylic acid dianion carboxylic acid dianions CHEBI:38716 carboxylic acid dianion carboxylic acid dianion ChEBI carboxylic acid dianion chebi carboxylic acid dianions ChEBI carboxylic acid dianions chebi A trianion containing at least one carboxy group. chebi_ontology carboxylic acid trianion carboxylic acid trianions CHEBI:38717 carboxylic acid trianion carboxylic acid trianion chebi carboxylic acid trianions chebi CHEBI:37074 chebi_ontology CHEBI:38793 pteroate CHEBI:26378 chebi_ontology Pteroic acid Pteroinsaeure CHEBI:38794 pteroic acid Pteroic acid chemidplus Pteroinsaeure chebi chebi_ontology CHEBI:38795 pteroic acids chebi_ontology CHEBI:38796 pteroates chebi_ontology halophenol halophenols CHEBI:38856 halophenol halophenol chebi halophenols chebi Substance which produces loss of feeling or sensation. chebi_ontology Anaesthetika Anaesthetikum anaesthetics anesthetic agent anesthetic drug anesthetics CHEBI:38867 anaesthetic Anaesthetika ChEBI Anaesthetika chebi Anaesthetikum ChEBI Anaesthetikum chebi anaesthetics ChEBI anaesthetics chebi anesthetic agent ChEBI anesthetic agent chebi anesthetic drug ChEBI anesthetic drug chebi anesthetics ChEBI anesthetics chebi A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The <em>N</em>-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency. A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency. DrugBank:DB01285 KEGG:C02017 KEGG:D00146 Corticotropin chebi_ontology ACTH Adrenocorticotropic hormone Corticotropin SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF adrenocorticotropin cortrophin CHEBI:3892 corticotropin Corticotropin KEGG_COMPOUND ACTH KEGG_COMPOUND ACTH kegg.compound Adrenocorticotropic hormone KEGG_COMPOUND Adrenocorticotropic hormone kegg.compound Corticotropin kegg.compound SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF DrugBank SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF drugbank adrenocorticotropin ChemIDplus adrenocorticotropin chemidplus cortrophin ChemIDplus cortrophin chemidplus An alkaloid containing an indole skeleton. CHEBI:24795 CHEBI:5901 KEGG:C06073 Wikipedia:Indole_alkaloid Indole alkaloid chebi_ontology Indole alkaloid indole alkaloids CHEBI:38958 indole alkaloid Indole alkaloid KEGG_COMPOUND Indole alkaloid kegg.compound indole alkaloids ChEBI indole alkaloids chebi Any alkylbenzene that is benzene substituted with one or more methyl groups. chebi_ontology methylbenzenes CHEBI:38975 methylbenzene methylbenzenes ChEBI methylbenzenes chebi A monocyclic arene that is benzene substituted with one or more alkyl groups. alkylbenzene chebi_ontology Alkylbenzol alkylbenzene alkylbenzenes CHEBI:38976 alkylbenzene alkylbenzene ChEBI Alkylbenzol ChEBI Alkylbenzol chebi alkylbenzene chebi alkylbenzenes ChEBI alkylbenzenes chebi Protein component on the surface of lipoprotein. chebi_ontology apolipoproteins CHEBI:39015 apolipoprotein apolipoproteins ChEBI apolipoproteins chebi A complex in which one component (the host) forms a cavity or, in the case of a crystal, a crystal lattice containing spaces in the shape of long tunnels or channels in which molecular entities of a second chemical species (the guest) are located. There is no covalent bonding between guest and host, the attraction being generally due to van der Waals forces. chebi_ontology compose d'inclusion compuesto de inclusion compuestos de inclusion inclusion complex inclusion compounds CHEBI:39022 inclusion compound compose d'inclusion IUPAC compose d'inclusion iupac compuesto de inclusion IUPAC compuesto de inclusion iupac compuestos de inclusion IUPAC compuestos de inclusion iupac inclusion complex IUPAC inclusion complex iupac inclusion compounds ChEBI inclusion compounds chebi Inclusion compound in which the guest molecule is in a cage formed by the host molecule or by a lattice of host molecules. chebi_ontology Clathrat Clathratverbindung Klathrat Klathratverbindung cage compound clathrate clathrate compounds clatrato clatratos compuesto de clatrato CHEBI:39024 clathrate compound Clathrat ChEBI Clathrat chebi Clathratverbindung ChEBI Clathratverbindung chebi Klathrat ChEBI Klathrat chebi Klathratverbindung ChEBI Klathratverbindung chebi cage compound IUPAC cage compound iupac clathrate IUPAC clathrate iupac clathrate compounds ChEBI clathrate compounds chebi clatrato IUPAC clatrato iupac clatratos IUPAC clatratos iupac compuesto de clatrato ChEBI compuesto de clatrato chebi calcium cation calcium cations CHEBI:39123 calcium cation calcium cation ChEBI calcium cations ChEBI calcium ion calcium ions CHEBI:39124 calcium ion calcium ion ChEBI calcium ions ChEBI A molecular entity capable of donating a hydron to an acceptor (Bronsted base). A molecular entity capable of donating a hydron to an acceptor (Brønsted base). chebi_ontology Bronsted-Saeure acide de Bronsted donneur d'hydron hydron donor CHEBI:39141 Bronsted acid Bronsted-Saeure ChEBI Bronsted-Saeure chebi acide de Bronsted IUPAC acide de Bronsted iupac donneur d'hydron IUPAC donneur d'hydron iupac hydron donor IUPAC hydron donor iupac A molecular entity capable of accepting a hydron from a donor (Bronsted acid). A molecular entity capable of accepting a hydron from a donor (Brønsted acid). chebi_ontology Bronsted-Base accepteur d'hydron base de Bronsted hydron acceptor CHEBI:39142 Bronsted base Bronsted-Base ChEBI Bronsted-Base chebi accepteur d'hydron IUPAC accepteur d'hydron iupac base de Bronsted IUPAC base de Bronsted iupac hydron acceptor IUPAC hydron acceptor iupac A molecular entity able to provide a pair of electrons and thus capable of forming a covalent bond with an electron-pair acceptor (Lewis acid), thereby producing a Lewis adduct. chebi_ontology Lewis-Base base de Lewis donneur d'une paire d'electrons electron donor CHEBI:39144 Lewis base Lewis-Base ChEBI Lewis-Base chebi base de Lewis IUPAC base de Lewis iupac donneur d'une paire d'electrons ChEBI donneur d'une paire d'electrons chebi electron donor ChEBI electron donor chebi Any saturated fatty acid lacking a side-chain. straight-chain saturated fatty acid chebi_ontology straight-chain saturated fatty acid straight-chain saturated fatty acids CHEBI:39418 straight-chain saturated fatty acid straight-chain saturated fatty acid ChEBI straight-chain saturated fatty acid chebi straight-chain saturated fatty acids ChEBI straight-chain saturated fatty acids chebi Any compound having a pyrimidine as part of its structure. CHEBI:13681 CHEBI:26448 chebi_ontology CHEBI:39447 pyrimidines A monovalent inorganic anion that consists of phosphoric acid in which one of the three OH groups has been deprotonated. CHEBI:29137 CHEBI:39739 DrugBank:DB02831 PDBeChem:2HP chebi_ontology DIHYDROGENPHOSPHATE ION H2PO4(-) [PO2(OH)2](-) CHEBI:39745 dihydrogenphosphate DIHYDROGENPHOSPHATE ION PDBeChem DIHYDROGENPHOSPHATE ION pdb-ccd H2PO4(-) IUPAC H2PO4(-) iupac [PO2(OH)2](-) IUPAC [PO2(OH)2](-) iupac KEGG:C02019 Cyclic ketone chebi_ontology Cyclic ketone CHEBI:3992 cyclic ketone Cyclic ketone KEGG_COMPOUND Cyclic ketone kegg.compound The <i>S</i>-enantiomer of adrenaline. The S-enantiomer of adrenaline. CHEBI:30615 CHEBI:40743 PDBeChem:ALE chebi_ontology (+)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol (+)-adrenaline (S)-(+)-adrenaline (S)-4-(1-hydroxy-2-(methylamino)ethyl)pyrocatechol d-adrenaline d-epinephrine CHEBI:40751 (S)-adrenaline (+)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol ChemIDplus (+)-3,4-dihydroxy-alpha-((methylamino)methyl)benzyl alcohol chemidplus (+)-adrenaline IUPHAR (+)-adrenaline iuphar (S)-(+)-adrenaline ChEBI (S)-(+)-adrenaline chebi (S)-4-(1-hydroxy-2-(methylamino)ethyl)pyrocatechol ChemIDplus (S)-4-(1-hydroxy-2-(methylamino)ethyl)pyrocatechol chemidplus d-adrenaline ChemIDplus d-adrenaline chemidplus d-epinephrine ChemIDplus d-epinephrine chemidplus CHEBI:23029 CHEBI:41396 chebi_ontology -CH2-COOH CARBOXYMETHYL GROUP aspartic acid side-chain CHEBI:41402 carboxymethyl group -CH2-COOH chebi CARBOXYMETHYL GROUP pdb-ccd aspartic acid side-chain chebi CHEBI:29201 CHEBI:41605 PDBeChem:CO3 carbonate chebi_ontology CARBONATE ION CO3(2-) Karbonat [CO3](2-) carbonate CHEBI:41609 carbonate carbonate IUPAC CARBONATE ION PDBeChem CARBONATE ION pdb-ccd CO3(2-) ChEBI CO3(2-) chebi Karbonat ChEBI Karbonat chebi [CO3](2-) IUPAC [CO3](2-) iupac carbonate iupac A glucopyranose having D-configuration. GlyGen:G15021LG GlyTouCan:G15021LG HMDB:HMDB0000122 KEGG:C00031 KEGG:D00009 KNApSAcK:C00001122 MetaCyc:D-Glucose Wikipedia:Glucose D-Glc D-Glcp D-Glucose D-glucose Dextrose Glc-OH Glucose Grape sugar WURCS=2.0/1,1,0/[a2122h-1x_1-5]/1/ glucose CHEBI:4167 D-glucopyranose D-Glc ChEBI D-Glcp ChEBI D-Glucose KEGG_COMPOUND D-glucose UniProt Dextrose KEGG_COMPOUND Glc-OH ChEBI Glucose KEGG_COMPOUND Grape sugar KEGG_COMPOUND WURCS=2.0/1,1,0/[a2122h-1x_1-5]/1/ GlyTouCan glucose ChEBI A hexose that has D-configuration at position 5. KEGG:C00738 D-Hexose D-hexoses a D-hexose CHEBI:4194 D-hexose D-Hexose KEGG_COMPOUND D-hexoses ChEBI a D-hexose UniProt An optically active form of lactic acid having (<i>R</i>)-configuration. CHEBI:341 CHEBI:42105 CHEBI:43701 chebi_ontology (-)-lactic acid (R)-(-)-lactic acid D-2-Hydroxypropanoic acid D-2-Hydroxypropionic acid D-Lactic acid D-Milchsaeure D-lactic acid LACTIC ACID CHEBI:42111 (R)-lactic acid (-)-lactic acid chemidplus (R)-(-)-lactic acid chemidplus D-2-Hydroxypropanoic acid kegg.compound D-2-Hydroxypropionic acid kegg.compound D-Lactic acid kegg.compound D-Milchsaeure chebi D-lactic acid chemidplus LACTIC ACID pdb-ccd An optically active form of lactic acid having (<i>S</i>)-configuration. chebi_ontology (+)-lactic acid (S)-(+)-lactic acid (S)-2-hydroxypropanoic acid (S)-2-hydroxypropionic acid L-(+)-alpha-hydroxypropionic acid L-(+)-lactic acid L-Lactic acid L-Milchsaeure CHEBI:422 (S)-lactic acid (+)-lactic acid nist (S)-(+)-lactic acid nist (S)-2-hydroxypropanoic acid nist (S)-2-hydroxypropionic acid nist L-(+)-alpha-hydroxypropionic acid chemidplus L-(+)-lactic acid nist L-Lactic acid kegg.compound L-Milchsaeure chebi CHEBI:24089 CHEBI:42480 PDBeChem:FOR FORMYL GROUP chebi_ontology -CH(O) -CHO FORMYL GROUP Fo H-CO- methanoyl CHEBI:42485 formyl group FORMYL GROUP PDBeChem -CH(O) IUPAC -CH(O) iupac -CHO IUPAC -CHO iupac FORMYL GROUP pdb-ccd Fo CBN Fo iubmb H-CO- IUPAC H-CO- iupac methanoyl IUPAC methanoyl iupac CHEBI:24706 CHEBI:43171 PDBeChem:OH HYDROXY GROUP hydroxy group chebi_ontology -OH HYDROXY GROUP hydroxy group hydroxyl hydroxyl group CHEBI:43176 hydroxy group HYDROXY GROUP PDBeChem hydroxy group UniProt -OH IUPAC -OH iupac HYDROXY GROUP pdb-ccd hydroxy group uniprot_ft hydroxyl ChEBI hydroxyl chebi hydroxyl group ChEBI hydroxyl group chebi chebi_ontology (4S)-4-hydroxy-3,4-dihydropyrimidin-2(1H)-one 4-HYDROXY-3,4-DIHYDRO-1H-PYRIMIDIN-2-ONE CHEBI:43254 (4S)-4-hydroxy-3,4-dihydropyrimidin-2(1H)-one (4S)-4-hydroxy-3,4-dihydropyrimidin-2(1H)-one pdb-ccd 4-HYDROXY-3,4-DIHYDRO-1H-PYRIMIDIN-2-ONE pdb-ccd A phosphate ion that is the conjugate base of dihydrogenphosphate. CHEBI:29139 CHEBI:43470 MolBase:1628 PDBeChem:PI PDBeChem:PO4 chebi_ontology HPO4(2-) HYDROGENPHOSPHATE ION INORGANIC PHOSPHATE GROUP [P(OH)O3](2-) [PO3(OH)](2-) hydrogen phosphate phosphate CHEBI:43474 hydrogenphosphate HPO4(2-) IUPAC HPO4(2-) iupac HYDROGENPHOSPHATE ION PDBeChem HYDROGENPHOSPHATE ION pdb-ccd INORGANIC PHOSPHATE GROUP PDBeChem INORGANIC PHOSPHATE GROUP pdb-ccd [P(OH)O3](2-) MolBase [P(OH)O3](2-) molbase [PO3(OH)](2-) IUPAC [PO3(OH)](2-) iupac hydrogen phosphate ChEBI hydrogen phosphate chebi phosphate UniProt phosphate uniprot_ft A primary aliphatic amine that is butane substituted by an amino group at position 1. chebi_ontology 1-Aminobutan 1-aminobutane 1-butanamine 1-butylamine BUTYLAMINE butanamine butylamine mono-n-butylamine monobutylamine n-Butylamin n-C4H9NH2 n-butylamine CHEBI:43799 butan-1-amine 1-Aminobutan chemidplus 1-aminobutane chemidplus 1-butanamine nist 1-butylamine nist BUTYLAMINE pdb-ccd butanamine nist butylamine chemidplus mono-n-butylamine chemidplus monobutylamine nist n-Butylamin chemidplus n-C4H9NH2 nist n-butylamine chemidplus CHEBI:30352 CHEBI:45554 chebi_ontology -CH(CH3)-CH2-CH3 CH3-CH2-CH(CH3)- SEC-BUTYL GROUP but-2-yl isoleucine side-chain s-butyl CHEBI:45557 sec-butyl group -CH(CH3)-CH2-CH3 chebi CH3-CH2-CH(CH3)- iupac SEC-BUTYL GROUP pdb-ccd but-2-yl chebi isoleucine side-chain chebi s-butyl chebi A nucleoside 5'-diphosphate(3-) arising from deprotonation of all three diphosphate OH groups of adenosine 5'-diphosphate (ADP); major species present at pH 7.3. A nucleoside 5'-diphosphate(3−) arising from deprotonation of all three diphosphate OH groups of adenosine 5'-diphosphate (ADP); major species present at pH 7.3. chebi_ontology 5'-O-[(phosphonatooxy)phosphinato]adenosine ADP ADP trianion CHEBI:456216 ADP(3-) 5'-O-[(phosphonatooxy)phosphinato]adenosine ChEBI 5'-O-[(phosphonatooxy)phosphinato]adenosine chebi ADP UniProt ADP uniprot_ft ADP trianion ChEBI ADP trianion chebi CHEBI:29199 CHEBI:45693 hydrogensulfate chebi_ontology HSO4(-) HYDROGEN SULFATE [SO3(OH)](-) hydrogensulfate CHEBI:45696 hydrogensulfate hydrogensulfate IUPAC HSO4(-) IUPAC HSO4(-) iupac HYDROGEN SULFATE PDBeChem HYDROGEN SULFATE pdb-ccd [SO3(OH)](-) IUPAC [SO3(OH)](-) iupac hydrogensulfate iupac An amino aldehyde that is L-tyrosine in which the carboxy group has undergone formal redution to give the corrresponding aldehyde CHEBI:46188 MetaCyc:CPD-21526 PDBeChem:TYB (2S)-2-amino-3-(p-hydroxyphenyl)propanal L-tyr aldehyde TYROSINAL CHEBI:46209 L-tyrosinal (2S)-2-amino-3-(p-hydroxyphenyl)propanal ChEBI L-tyr aldehyde ChEBI TYROSINAL PDBeChem CHEBI:29353 CHEBI:44607 PDBeChem:O OXO GROUP chebi_ontology =O OXO GROUP CHEBI:46629 oxo group OXO GROUP PDBeChem =O IUPAC =O iupac OXO GROUP pdb-ccd In general, a mineral is a chemical substance that is normally crystalline formed and has been formed as a result of geological processes. The term also includes metamict substances (naturally occurring, formerly crystalline substances whose crystallinity has been destroyed by ionising radiation) and can include naturally occurring amorphous substances that have never been crystalline ('mineraloids') such as georgite and calciouranoite as well as substances formed by the action of geological processes on bigenic compounds ('biogenic minerals'). Wikipedia:Mineral mineral chebi_ontology Minerale mineral minerales minerals mineraux CHEBI:46662 mineral mineral ChEBI Minerale ChEBI Minerale chebi mineral chebi minerales ChEBI minerales chebi minerals ChEBI minerals chebi mineraux ChEBI mineraux chebi chebi_ontology pyrrolidinemonocarboxylic acids CHEBI:46701 pyrrolidinemonocarboxylic acid pyrrolidinemonocarboxylic acids chebi carbonate salts CHEBI:46721 carbonate salt carbonate salts ChEBI phosphate minerals CHEBI:46723 phosphate mineral phosphate minerals ChEBI chebi_ontology pyrrolidinecarboxylic acids CHEBI:46767 pyrrolidinecarboxylic acid pyrrolidinecarboxylic acids chebi chebi_ontology hydroxypyrrolidines CHEBI:46773 hydroxypyrrolidine hydroxypyrrolidines chebi A liquid that can dissolve other substances (solutes) without any change in their chemical composition. Wikipedia:Solvent chebi_ontology Loesungsmittel solvant solvents CHEBI:46787 solvent Loesungsmittel ChEBI Loesungsmittel chebi solvant ChEBI solvant chebi solvents ChEBI solvents chebi An organic anion obtained by removal of at least one proton from any uric acid. chebi_ontology urate anion CHEBI:46818 urate anion urate anion chebi An organic salt of uric acid. chebi_ontology urate urates CHEBI:46819 urate salt urate chebi urates chebi CHEBI:29975 CHEBI:46207 PDBeChem:TYR_LL RESID:AA0019 L-tyrosine residue L-tyrosine L-tyrosine acid residue L-tyrosyl Tyr Y CHEBI:46858 L-tyrosine residue L-tyrosine residue JCBN UniProt L-tyrosine RESID L-tyrosine acid residue JCBN L-tyrosyl ChEBI Tyr JCBN Y JCBN CHEBI:23025 CHEBI:41420 PDBeChem:FMT CARBOXY GROUP chebi_ontology -C(O)OH -CO2H -COOH CARBOXY GROUP carboxyl group CHEBI:46883 carboxy group CARBOXY GROUP PDBeChem -C(O)OH IUPAC -C(O)OH iupac -CO2H ChEBI -CO2H chebi -COOH IUPAC -COOH iupac CARBOXY GROUP pdb-ccd carboxyl group ChEBI carboxyl group chebi A dicarboxylic acid monoanion that is the conjugate base of oxalic acid. chebi_ontology Hox hydrogen ethanedioate hydrogen oxalate CHEBI:46904 oxalate(1-) Hox iupac hydrogen ethanedioate iupac hydrogen oxalate chebi chebi_ontology ornithine monocation ornithinium(1+) CHEBI:46912 ornithinium(1+) ornithine monocation jcbn ornithinium(1+) jcbn chebi_ontology ornithine dication ornithinium(2+) CHEBI:46913 ornithinium(2+) ornithine dication jcbn ornithinium(2+) jcbn An aminodiol composed of any octadecene having hydroxy functional groups at positions 1 and 3 and an amino substituent at position 2. chebi_ontology 2-aminooctadecene-1,3-diols CHEBI:46963 2-aminooctadecene-1,3-diol 2-aminooctadecene-1,3-diols chebi A 2-aminooctadecene-1,3-diol having its double bond at position 4. chebi_ontology 2-aminooctadec-4-ene-1,3-diols CHEBI:46964 2-aminooctadec-4-ene-1,3-diol 2-aminooctadec-4-ene-1,3-diols chebi A 2-aminooctadec-4-ene-1,3-diol having (2<i>R</i>,3<i>S</i>)-configuration. chebi_ontology CHEBI:46965 (2R,3S)-2-aminooctadec-4-ene-1,3-diol A (2<i>R</i>,3<i>S</i>)-2-aminooctadec-4-ene-1,3-diol in which the double bond has <i>E</i> geochemistry. CHEBI:78744 chebi_ontology L-Erythro-c18-sphingosine L-erythro-sphing-4-enine CHEBI:46967 L-erythro-sphingosine L-Erythro-c18-sphingosine chemidplus L-erythro-sphing-4-enine chebi A ribose in which the chiral carbon atom furthest away from the aldehyde group (C4') has the same configuration as in <small>L</small>-glyceraldehyde. A ribose in which the chiral carbon atom furthest away from the aldehyde group (C4') has the same configuration as in L-glyceraldehyde. chebi_ontology L-Rib CHEBI:46997 L-ribose L-Rib JCBN L-Rib jcbn A cyclic ribose having a 5-membered tetrahydrofuran ring; the predominant (C3'-endo) form of the two cyclic structures (the other is the "C2'-endo" form, having a 6-membered ring) adopted by ribose in aqueous solution. chebi_ontology rel-(3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol CHEBI:46998 ribofuranose rel-(3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol IUPAC rel-(3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol iupac A ribofuranose having <small>D</small>-configuration. A ribofuranose having D-configuration. CHEBI:4233 CHEBI:46999 GlyTouCan:G31080DL KEGG:C00121 Patent:US2152662 D-Ribose chebi_ontology (3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol D-Ribose D-ribose WURCS=2.0/1,1,0/[a222h-1x_1-4]/1/ ribose CHEBI:47013 D-ribofuranose D-Ribose KEGG_COMPOUND (3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol IUPAC (3R,4S,5R)-5-(hydroxymethyl)tetrahydrofuran-2,3,4-triol iupac D-Ribose KEGG_COMPOUND D-Ribose kegg.compound D-ribose UniProt D-ribose uniprot_ft WURCS=2.0/1,1,0/[a222h-1x_1-4]/1/ GlyTouCan ribose ChemIDplus ribose chemidplus chebi_ontology tetrahydrofuranols CHEBI:47017 tetrahydrofuranol tetrahydrofuranols ChEBI tetrahydrofuranols chebi chebi_ontology dihydroxytetrahydrofurans CHEBI:47019 dihydroxytetrahydrofuran dihydroxytetrahydrofurans ChEBI dihydroxytetrahydrofurans chebi Any carboxylic ester where the carboxylic acid component is acetic acid. CHEBI:13244 CHEBI:13799 CHEBI:22189 CHEBI:2406 KEGG:C01883 Wikipedia:Acetate#Esters chebi_ontology Acetic ester Acetyl ester acetate acetate esters acetates acetyl esters an acetyl ester CHEBI:47622 acetate ester Acetic ester KEGG_COMPOUND Acetic ester kegg.compound Acetyl ester KEGG_COMPOUND Acetyl ester kegg.compound acetate ChEBI acetate chebi acetate esters ChEBI acetate esters chebi acetates ChEBI acetates chebi acetyl esters ChEBI acetyl esters chebi an acetyl ester UniProt an acetyl ester uniprot_ft Cholesterol esters and free cholesterol which are contained in or bound to very low density lipoproteins (VLDL). chebi_ontology VLDL cholesterol VLDL-C pre-beta-lipoprotein cholesterol CHEBI:47773 very-low-density lipoprotein cholesterol VLDL cholesterol chebi VLDL-C chebi pre-beta-lipoprotein cholesterol chebi Cholesterol esters and free cholesterol which are contained in or bound to low-density lipoproteins (LDL). chebi_ontology LDL cholesterol LDL-C beta-lipoprotein cholesterol CHEBI:47774 low-density lipoprotein cholesterol LDL cholesterol chebi LDL-C chebi beta-lipoprotein cholesterol chebi Cholesterol esters and free cholesterol which are contained in or bound to high-density lipoproteins (HDL). chebi_ontology HDL cholesterol HDL-C alpha-lipoprotein cholesterol CHEBI:47775 high-density lipoprotein cholesterol HDL cholesterol chebi HDL-C chebi alpha-lipoprotein cholesterol chebi Triglycerides which are contained in very low density lipoproteins (VLDL). chebi_ontology VLDL triacylglycerol VLDL triglyceride very-low-density lipoprotein triglycerides CHEBI:47776 very-low-density lipoprotein triglyceride VLDL triacylglycerol chebi VLDL triglyceride chebi very-low-density lipoprotein triglycerides chebi Any ester resulting from the condensation of one or more of the hydroxy groups of glycerol (propane-1,2,3-triol) with fatty acids. CHEBI:13730 CHEBI:22230 chebi_ontology acylglycerols glyceride glycerides CHEBI:47778 glyceride acylglycerols chebi glyceride chebi glycerides chebi Any oxo steroid where an oxo substituent is located at position 3. CHEBI:13607 CHEBI:1653 CHEBI:20182 CHEBI:71186 KEGG:C01876 MetaCyc:3-Oxosteroids chebi_ontology 3-Oxosteroid 3-oxo steroids 3-oxosteroids a 3-oxosteroid CHEBI:47788 3-oxo steroid 3-Oxosteroid KEGG_COMPOUND 3-Oxosteroid kegg.compound 3-oxo steroids ChEBI 3-oxo steroids chebi 3-oxosteroids ChEBI 3-oxosteroids chebi a 3-oxosteroid UniProt a 3-oxosteroid uniprot_ft Anything used in a scientific experiment to indicate the presence of a substance or quality, change in a body, etc. chebi_ontology Indikator CHEBI:47867 indicator Indikator chebi chebi_ontology cyclic polypyrroles polypyrrole macrocycles CHEBI:47882 cyclic polypyrrole cyclic polypyrroles ChEBI cyclic polypyrroles chebi polypyrrole macrocycles ChEBI polypyrrole macrocycles chebi Any steroid substituted by at least one carboxy group. steroid acids CHEBI:47891 steroid acid steroid acids ChEBI Organic derivatives of sulfonic acid in which the sulfo group is linked directly to carbon of an alkyl group. CHEBI:13809 CHEBI:33553 chebi_ontology alkanesulfonic acids alkylsulfonic acids CHEBI:47901 alkanesulfonic acid alkanesulfonic acids chebi alkylsulfonic acids chebi A 3-oxo steroid conjugated to a C=C double bond at the alpha,beta position. A 3-oxo steroid conjugated to a C=C double bond at the α,β position. CHEBI:13604 CHEBI:1626 CHEBI:20157 KEGG:C00619 MetaCyc:3-Oxo-Delta-4-Steroids chebi_ontology 3-Oxo-delta4-steroid 3-oxo Delta(4)-steroid 3-oxo Delta(4)-steroids 3-oxo-Delta(4) steroids a 3-oxo-Delta(4)-steroid CHEBI:47909 3-oxo-Delta(4) steroid 3-Oxo-delta4-steroid KEGG_COMPOUND 3-Oxo-delta4-steroid kegg.compound 3-oxo Delta(4)-steroid ChEBI 3-oxo Delta(4)-steroid chebi 3-oxo Delta(4)-steroids ChEBI 3-oxo Delta(4)-steroids chebi 3-oxo-Delta(4) steroids ChEBI 3-oxo-Delta(4) steroids chebi a 3-oxo-Delta(4)-steroid UniProt a 3-oxo-Delta(4)-steroid uniprot_ft Any oligopeptide that consists of three amino-acid residues connected by peptide linkages. CHEBI:27138 CHEBI:9742 chebi_ontology Tripeptide tripeptides CHEBI:47923 tripeptide Tripeptide kegg.compound tripeptides chebi chebi_ontology Schwefeloxide oxides of sulfur sulfur oxides CHEBI:48154 sulfur oxide Schwefeloxide ChEBI Schwefeloxide chebi oxides of sulfur ChEBI oxides of sulfur chebi sulfur oxides ChEBI sulfur oxides chebi An antimicrobial agent that is applied to non-living objects to destroy harmful microorganisms or to inhibit their activity. chebi_ontology Desinfektionsmittel desinfectant disinfectants disinfecting agent CHEBI:48219 disinfectant Desinfektionsmittel chebi desinfectant chebi disinfectants chebi disinfecting agent chebi Compounds of structure RSSR'. chebi_ontology disulfides CHEBI:48343 disulfide disulfides chebi A solvent that is composed of polar molecules. Polar solvents can dissolve ionic compounds or ionisable covalent compounds. chebi_ontology polar solvents CHEBI:48354 polar solvent polar solvents ChEBI polar solvents chebi chebi_ontology non-polar solvents CHEBI:48355 non-polar solvent non-polar solvents chebi A polar solvent that is capable of acting as a hydron (proton) donor. chebi_ontology CHEBI:48356 protic solvent Solvent that is capable of acting as a hydron (proton) acceptor. chebi_ontology HBA solvent hydrogen bond acceptor solvent CHEBI:48359 protophilic solvent HBA solvent ChEBI HBA solvent chebi hydrogen bond acceptor solvent ChEBI hydrogen bond acceptor solvent chebi Self-ionizing solvent possessing both characteristics of Bronsted acids and bases. Self-ionizing solvent possessing both characteristics of Brønsted acids and bases. chebi_ontology CHEBI:48360 amphiprotic solvent chebi_ontology H2N-C(=NH)-OH H2N-C(OH)=NH HO-C(=NH)-NH2 Isoharnstoff carbamimic acid carbonamidimidic acid isourea pseudourea CHEBI:48376 carbamimidic acid H2N-C(=NH)-OH iupac H2N-C(OH)=NH iupac HO-C(=NH)-NH2 iupac Isoharnstoff chebi carbamimic acid chemidplus carbonamidimidic acid iupac isourea chemidplus pseudourea chemidplus Compounds derived from oxoacids R<small>_<em>k</em></small>E(=O)<small>_<em>l</em></small>(OH)<small>_<em>m</em></small> (<em>l</em> ≠ 0) by replacing =O by =NR; thus tautomers of amides. In organic chemistry an unspecified imidic acid is generally a carboximidic acid, RC(=NR)(OH). chebi_ontology imidic acid imidic acids imino acids CHEBI:48377 imidic acid imidic acid chebi imidic acids chebi imino acids iupac chebi_ontology carboximidic acid carboximidic acids CHEBI:48378 carboximidic acid carboximidic acid chebi carboximidic acids chebi A carboximidic acid that is the imidic acid tautomer of urea, H<small>₂</small>NC(=NH)OH, and its hydrocarbyl derivatives. chebi_ontology isoureas CHEBI:48379 isourea isoureas chebi Any drug that acts on an alpha-adrenergic receptor. Any drug that acts on an α-adrenergic receptor. chebi_ontology alpha-adrenergic drugs CHEBI:48539 alpha-adrenergic drug alpha-adrenergic drugs ChEBI alpha-adrenergic drugs chebi Any of the drugs that act on beta-adrenergic receptors. Any of the drugs that act on β-adrenergic receptors. chebi_ontology beta-adrenergic drugs CHEBI:48540 beta-adrenergic drug beta-adrenergic drugs ChEBI beta-adrenergic drugs chebi Esters or salts of methanesulfonic acid. chebi_ontology CHEBI:48544 methanesulfonates A drug used for its effects on dopamine receptors, on the life cycle of dopamine, or on the survival of dopaminergic neurons. chebi_ontology dopamine agent dopamine agents dopamine drug dopamine drugs dopaminergic agents CHEBI:48560 dopaminergic agent dopamine agent ChEBI dopamine agent chebi dopamine agents ChEBI dopamine agents chebi dopamine drug ChEBI dopamine drug chebi dopamine drugs ChEBI dopamine drugs chebi dopaminergic agents ChEBI dopaminergic agents chebi A role played by a substance that can react readily with, and thereby eliminate, radicals. chebi_ontology free radical scavengers free-radical scavenger CHEBI:48578 radical scavenger free radical scavengers ChEBI free radical scavengers chebi free-radical scavenger ChEBI free-radical scavenger chebi Substance which binds to cell receptors normally responding to naturally occurring substances and which produces a response of its own. chebi_ontology agonista agoniste agonists CHEBI:48705 agonist agonista ChEBI agonista chebi agoniste ChEBI agoniste chebi agonists ChEBI agonists chebi Substance that attaches to and blocks cell receptors that normally bind naturally occurring substances. chebi_ontology antagonista antagoniste antagonists CHEBI:48706 antagonist antagonista ChEBI antagonista chebi antagoniste ChEBI antagoniste chebi antagonists ChEBI antagonists chebi CHEBI:26837 CHEBI:9344 Sulfite chebi_ontology H2SO3 S(O)(OH)2 Sulfite Sulfurous acid [SO(OH)2] acide sulfureux acido sulfuroso schweflige Saeure sulphurous acid CHEBI:48854 sulfurous acid Sulfite KEGG_COMPOUND H2SO3 iupac S(O)(OH)2 iupac Sulfite kegg.compound Sulfurous acid kegg.compound [SO(OH)2] iupac acide sulfureux chebi acido sulfuroso chebi schweflige Saeure chemidplus sulphurous acid chemidplus Any drug that binds to but does not activate cholinergic receptors, thereby blocking the actions of acetylcholine or cholinergic agonists. chebi_ontology Anticholinergika Anticholinergikum acetylcholine antagonists acetylcholine receptor antagonist agent anticholinergique agente anticolinergico agentes anticolinergicos anticholinergic agents anticholinergics anticholinergiques anticolinergicos cholinergic-blocking agents CHEBI:48873 cholinergic antagonist Anticholinergika ChEBI Anticholinergika chebi Anticholinergikum ChEBI Anticholinergikum chebi acetylcholine antagonists ChEBI acetylcholine antagonists chebi acetylcholine receptor antagonist IUPHAR acetylcholine receptor antagonist iuphar agent anticholinergique ChEBI agent anticholinergique chebi agente anticolinergico ChEBI agente anticolinergico chebi agentes anticolinergicos ChEBI agentes anticolinergicos chebi anticholinergic agents ChEBI anticholinergic agents chebi anticholinergics ChEBI anticholinergics chebi anticholinergiques ChEBI anticholinergiques chebi anticolinergicos ChEBI anticolinergicos chebi cholinergic-blocking agents ChEBI cholinergic-blocking agents chebi An azole in which the five-membered heterocyclic aromatic skeleton contains a N atom and one S atom. chebi_ontology thiazole CHEBI:48901 thiazoles thiazole chebi Any <small>L</small>-α-amino acid carrying an <em>N</em>-acyl substituent. CHEBI:13240 CHEBI:7232 chebi_ontology N-Acyl-L-amino acid CHEBI:48927 N-acyl-L-alpha-amino acid N-Acyl-L-amino acid kegg.compound chebi_ontology beta-amino acid anions beta-amino-acid anion beta-amino-acid anions CHEBI:49095 beta-amino-acid anion beta-amino acid anions chebi beta-amino-acid anion chebi beta-amino-acid anions chebi CHEBI:19626 CHEBI:35967 chebi_ontology 2-hydroxy acid 2-hydroxy monocarboxylic acids CHEBI:49302 2-hydroxy monocarboxylic acid 2-hydroxy acid chebi 2-hydroxy monocarboxylic acids chebi A chemical substance that prevents or reduces the probability of conception. chebi_ontology contraceptive agent contraceptive drugs CHEBI:49323 contraceptive drug contraceptive agent ChEBI contraceptive agent chebi contraceptive drugs ChEBI contraceptive drugs chebi CHEBI:24634 CHEBI:49636 WebElements:H chebi_ontology 1H H Wasserstoff hidrogeno hydrogen hydrogene CHEBI:49637 hydrogen atom 1H IUPAC 1H iupac H IUPAC H iupac Wasserstoff ChEBI Wasserstoff chebi hidrogeno ChEBI hidrogeno chebi hydrogen ChEBI hydrogen chebi hydrogene ChEBI hydrogene chebi A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by organyl groups. chebi_ontology organic amino compounds CHEBI:50047 organic amino compound organic amino compounds ChEBI organic amino compounds chebi An agent that binds to and activates excitatory amino acid receptors. chebi_ontology excitatory amino acid agonists excitatory amino acid receptor agonist excitatory amino acid receptor agonists CHEBI:50103 excitatory amino acid agonist excitatory amino acid agonists chebi excitatory amino acid receptor agonist chebi excitatory amino acid receptor agonists chebi Any hormone that is responsible for controlling sexual characteristics and reproductive function. chebi_ontology Geschlechtshormon Geschlechtshormone Sexualhormon Sexualhormone hormone sexuelle hormones sexuelles sex hormones CHEBI:50112 sex hormone Geschlechtshormon ChEBI Geschlechtshormon chebi Geschlechtshormone ChEBI Geschlechtshormone chebi Sexualhormon ChEBI Sexualhormon chebi Sexualhormone ChEBI Sexualhormone chebi hormone sexuelle ChEBI hormone sexuelle chebi hormones sexuelles ChEBI hormones sexuelles chebi sex hormones ChEBI sex hormones chebi A sex hormone that stimulates or controls the development and maintenance of masculine characteristics in vertebrates by binding to androgen receptors. Androgen chebi_ontology Androgen Androgene androgene androgenes androgeno androgenos androgens CHEBI:50113 androgen Androgen ChEBI Androgen chebi Androgene ChEBI Androgene chebi androgene ChEBI androgene chebi androgenes ChEBI androgenes chebi androgeno ChEBI androgeno chebi androgenos ChEBI androgenos chebi androgens ChEBI androgens chebi A hormone that stimulates or controls the development and maintenance of female sex characteristics in mammals by binding to oestrogen receptors. The oestrogens are named for their importance in the oestrous cycle. The oestrogens that occur naturally in the body, notably estrone, estradiol, estriol, and estetrol are steroids. Other compounds with oestrogenic activity are produced by plants (phytoestrogens) and fungi (mycoestrogens); synthetic compounds with oestrogenic activity are known as xenoestrogens. chebi_ontology Estrogene Oestrogen Oestrogene estrogene estrogenes estrogenes Hormon estrogeno estrogenos estrogens oestrogen oestrogene oestrogenes oestrogens CHEBI:50114 estrogen Estrogene chebi Oestrogen chebi Oestrogene chebi estrogene chebi estrogenes chebi estrogenes Hormon chebi estrogeno chebi estrogenos chebi estrogens chebi oestrogen chebi oestrogene chebi oestrogenes chebi oestrogens chebi Any anion formed by loss of a proton from a steroid acid. steroid acid anions CHEBI:50160 steroid acid anion steroid acid anions ChEBI A retinoid consisting of 3,7-dimethylnona-2,4,6,8-tetraen-1-ol substituted at position 9 by a 2,6,6-trimethylcyclohex-1-en-1-yl group (geometry of the four exocyclic double bonds is not specified). CHEBI:15037 CHEBI:26538 chebi_ontology retinol CHEBI:50211 retinol retinol uniprot_ft A compound that, on administration, must undergo chemical conversion by metabolic processes before becoming the pharmacologically active drug for which it is a prodrug. chebi_ontology Prodrugs CHEBI:50266 prodrug Prodrugs chebi Synthetic or natural substance which is given to prevent a disease or disorder or are used in the process of treating a disease or injury due to a poisonous agent. chebi_ontology chemoprotectant chemoprotectants chemoprotective agent chemoprotective agents protective agents CHEBI:50267 protective agent chemoprotectant ChEBI chemoprotectant chebi chemoprotectants ChEBI chemoprotectants chebi chemoprotective agent ChEBI chemoprotective agent chebi chemoprotective agents ChEBI chemoprotective agents chebi protective agents ChEBI protective agents chebi canonical nucleotide residues CHEBI:50297 canonical nucleotide residue canonical nucleotide residues ChEBI canonical deoxyribonucleotide residues CHEBI:50298 canonical deoxyribonucleotide residue canonical deoxyribonucleotide residues ChEBI canonical ribonucleotide residues CHEBI:50299 canonical ribonucleotide residue canonical ribonucleotide residues ChEBI chebi_ontology onium compound onium compounds CHEBI:50312 onium compound onium compound chebi onium compounds chebi Mononuclear cations derived by addition of a hydron to a mononuclear parent hydride of the pnictogen, chalcogen and halogen families. chebi_ontology onium cations onium ion onium ions CHEBI:50313 onium cation onium cations ChEBI onium cations chebi onium ion ChEBI onium ion chebi onium ions ChEBI onium ions chebi chebi_ontology H2Cl(+) [ClH2](+) CHEBI:50315 chloronium H2Cl(+) iupac [ClH2](+) iupac nucleotide residues CHEBI:50319 nucleotide residue nucleotide residues ChEBI nucleoside residues CHEBI:50320 nucleoside residue nucleoside residues ChEBI A univalent organyl group obtained by cleaving the bond from C-2 to the side chain of a proteinogenic amino-acid. chebi_ontology canonical amino-acid side-chain canonical amino-acid side-chains proteinogenic amino-acid side-chain proteinogenic amino-acid side-chain groups proteinogenic amino-acid side-chains CHEBI:50325 proteinogenic amino-acid side-chain group canonical amino-acid side-chain ChEBI canonical amino-acid side-chain chebi canonical amino-acid side-chains ChEBI canonical amino-acid side-chains chebi proteinogenic amino-acid side-chain ChEBI proteinogenic amino-acid side-chain chebi proteinogenic amino-acid side-chain groups ChEBI proteinogenic amino-acid side-chain groups chebi proteinogenic amino-acid side-chains ChEBI proteinogenic amino-acid side-chains chebi chebi_ontology -CH2-SH HS-CH2- cysteine side-chain CHEBI:50326 sulfanylmethyl group -CH2-SH iupac HS-CH2- iupac cysteine side-chain chebi chebi_ontology glutamic acid side-chain CHEBI:50329 2-carboxyethyl group glutamic acid side-chain ChEBI glutamic acid side-chain chebi chebi_ontology glutamine side-chain CHEBI:50331 3-amino-3-oxopropyl group glutamine side-chain chebi chebi_ontology tyrosine side-chain CHEBI:50336 4-hydroxybenzyl group tyrosine side-chain ChEBI tyrosine side-chain chebi chebi_ontology tryptophan side-chain CHEBI:50337 1H-indol-3-ylmethyl group tryptophan side-chain chebi chebi_ontology histidine side-chain CHEBI:50338 1H-imidazol-4-ylmethyl group histidine side-chain chebi chebi_ontology lysine side-chain CHEBI:50339 4-aminobutyl group lysine side-chain chebi chebi_ontology 3-(carbamimidoylamino)propyl 3-guanidinopropyl arginine side-chain CHEBI:50340 3-carbamimidamidopropyl group 3-(carbamimidoylamino)propyl iupac 3-guanidinopropyl chebi arginine side-chain chebi chebi_ontology threonine side-chain CHEBI:50341 1-hydroxyethyl group threonine side-chain chebi Any steroid based on a cholestane skeleton and its derivatives. chebi_ontology cholestanoids CHEBI:50401 cholestanoid cholestanoids chebi Any steroid based on an androstane skeleton and its derivatives. chebi_ontology androstanoids CHEBI:50402 androstanoid androstanoids ChEBI androstanoids chebi Cholesterol esters and free cholesterol which are contained in or bound to lipoproteins. chebi_ontology CHEBI:50404 lipoprotein cholesterol Agent that dilates the pupil. Used in eye diseases and to facilitate eye examination. It may be either a sympathomimetic or parasympatholytic. The latter cause cycloplegia or paralysis of accommodation at high doses and may precipitate glaucoma. chebi_ontology mydriatics CHEBI:50513 mydriatic agent mydriatics ChEBI mydriatics chebi Drug used to cause constriction of the blood vessels. chebi_ontology CHEBI:50514 vasoconstrictor agent A γ-lactone that consists of a 2-furanone skeleton and its substituted derivatives. CHEBI:22960 CHEBI:38121 chebi_ontology 2-furanone 2-furanones butenolides furan-2-ones CHEBI:50523 butenolide 2-furanone chebi 2-furanones chebi butenolides chebi furan-2-ones chebi An aliphatic alcohol in which the aliphatic alkane chain is substituted by a hydroxy group at unspecified position. CHEBI:22937 CHEBI:50581 chebi_ontology alkyl alcohols hydroxyalkane hydroxyalkanes CHEBI:50584 alkyl alcohol alkyl alcohols chebi hydroxyalkane chebi hydroxyalkanes chebi An agent that inhibits bone resorption and/or favor bone mineralization and bone regeneration. Used to heal bone fractures and to treat bone diseases such as osteopenia and osteoporosis. CHEBI:72497 Wikipedia:Osteoporosis anti-osteopenia agent anti-osteopenia agents anti-osteopenia drug anti-osteopenia drugs anti-osteoporosis agent anti-osteoporosis agents anti-osteoporosis drug anti-osteoporosis drugs anti-osteoporotic anti-osteoporotic agent anti-osteoporotic agents anti-osteoporotic drug anti-osteoporotic drugs anti-osteoporotics antiosteoporotic antiosteoporotics bone density conservation agents bone density conservation drug bone density conservation drugs CHEBI:50646 bone density conservation agent anti-osteopenia agent ChEBI anti-osteopenia agents ChEBI anti-osteopenia drug ChEBI anti-osteopenia drugs ChEBI anti-osteoporosis agent ChEBI anti-osteoporosis agents ChEBI anti-osteoporosis drug ChEBI anti-osteoporosis drugs ChEBI anti-osteoporotic ChEBI anti-osteoporotic agent ChEBI anti-osteoporotic agents ChEBI anti-osteoporotic drug ChEBI anti-osteoporotic drugs ChEBI anti-osteoporotics ChEBI antiosteoporotic ChEBI antiosteoporotics ChEBI bone density conservation agents ChEBI bone density conservation drug ChEBI bone density conservation drugs ChEBI A substance used either in the prevention or facilitation of pregnancy. chebi_ontology reproductive control agent reproductive control drugs CHEBI:50689 reproductive control drug reproductive control agent ChEBI reproductive control agent chebi reproductive control drugs ChEBI reproductive control drugs chebi A product in capsule, tablet or liquid form that provide essential nutrients, such as a vitamin, an essential mineral, a protein, an herb, or similar nutritional substance. chebi_ontology Dietary Supplement Food Supplementation Nutritional supplement CHEBI:50733 nutraceutical Dietary Supplement ChEBI Dietary Supplement chebi Food Supplementation ChEBI Food Supplementation chebi Nutritional supplement ChEBI Nutritional supplement chebi The zwitterion formed from taurine by transfer of a proton from the sulfonyl to the amino group. It is the major species existing at physiological pH. chebi_ontology 2-ammonioethanesulfonate taurine CHEBI:507393 taurine zwitterion 2-ammonioethanesulfonate iupac taurine uniprot_ft A compound that interacts with progesterone receptors in target tissues to bring about effects similar to those of progesterone. chebi_ontology gestagen gestagens progestagen progestagens progestogens CHEBI:50745 progestogen gestagen ChEBI gestagen chebi gestagens ChEBI gestagens chebi progestagen ChEBI progestagen chebi progestagens ChEBI progestagens chebi progestogens ChEBI progestogens chebi A drug which increases appetite. chebi_ontology appetite enhancing drug appetite stimulant orexigenic CHEBI:50779 appetite enhancer appetite enhancing drug chebi appetite stimulant chebi orexigenic chebi An agent which regulates the physiologic mechanisms that control the appetite and food intake. chebi_ontology appetite regulators CHEBI:50780 appetite regulator appetite regulators chebi Biologically active substance whose activity affects or plays a role in the functioning of the immune system. Wikipedia:Immunotherapy Biomodulator Immune factor Immunologic factor Immunological factor immunomodulators CHEBI:50846 immunomodulator Biomodulator ChEBI Immune factor ChEBI Immunologic factor ChEBI Immunological factor ChEBI immunomodulators ChEBI A substance that augments, stimulates, activates, potentiates, or modulates the immune response at either the cellular or humoral level. A classical agent (Freund's adjuvant, BCG, Corynebacterium parvum, et al.) contains bacterial antigens. It could also be endogenous (e.g., histamine, interferon, transfer factor, tuftsin, interleukin-1). Its mode of action is either non-specific, resulting in increased immune responsiveness to a wide variety of antigens, or antigen-specific, i.e., affecting a restricted type of immune response to a narrow group of antigens. The therapeutic efficacy is related to its antigen-specific immunoadjuvanticity. Wikipedia:Immunologic_adjuvant Immunoactivator Immunoadjuvant Immunologic adjuvant Immunopotentiator Immunostimulant CHEBI:50847 immunological adjuvant Immunoactivator ChEBI Immunoadjuvant ChEBI Immunologic adjuvant ChEBI Immunopotentiator ChEBI Immunostimulant ChEBI A cardiovascular drug that prevents atherogenesis, the accumulation of lipid-containing plaques on the innermost layers of the arteries. Compare with <a href="https://www.ebi.ac.uk/chebi/searchId.do?chebiId=CHEBI:145947" target="_blank">antiatherosclerotic agent</a>. chebi_ontology anti-atherogenic agent anti-atherogenic agents anti-atherogenic drug anti-atherogenic drugs antiatherogenic agent antiatherogenic agents antiatherogenic drug antiatherogenic drugs CHEBI:50855 antiatherogenic agent anti-atherogenic agent chebi anti-atherogenic agents chebi anti-atherogenic drug chebi anti-atherogenic drugs chebi antiatherogenic agent chebi antiatherogenic agents chebi antiatherogenic drug chebi antiatherogenic drugs chebi A natural or synthetic analogue of the hormones secreted by the adrenal gland. chebi_ontology corticoides corticosteroides corticosteroids CHEBI:50858 corticosteroid corticoides ChEBI corticoides chebi corticosteroides ChEBI corticosteroides chebi corticosteroids ChEBI corticosteroids chebi Any molecular entity that contains carbon. CHEBI:25700 CHEBI:33244 chebi_ontology organic compounds organic entity organic molecular entities CHEBI:50860 organic molecular entity organic compounds ChEBI organic compounds chebi organic entity ChEBI organic entity chebi organic molecular entities ChEBI organic molecular entities chebi A role played by a chemical compound to induce direct or indirect DNA damage. Such damage can potentially lead to the formation of a malignant tumour, but DNA damage does not lead inevitably to the creation of cancerous cells. chebi_ontology genotoxic agent genotoxic agents genotoxins CHEBI:50902 genotoxin genotoxic agent chebi genotoxic agents chebi genotoxins chebi A role played by a chemical compound which is known to induce a process of carcinogenesis by corrupting normal cellular pathways, leading to the acquistion of tumoral capabilities. chebi_ontology agente carcinogeno cancerigene cancerogene carcinogen carcinogene carcinogenic agents carcinogeno carcinogens CHEBI:50903 carcinogenic agent agente carcinogeno ChEBI agente carcinogeno chebi cancerigene ChEBI cancerigene chebi cancerogene ChEBI cancerogene chebi carcinogen ChEBI carcinogen chebi carcinogene ChEBI carcinogene chebi carcinogenic agents ChEBI carcinogenic agents chebi carcinogeno ChEBI carcinogeno chebi carcinogens ChEBI carcinogens chebi A chemical compound, or part thereof, which causes the onset of an allergic reaction by interacting with any of the molecular pathways involved in an allergy. Wikipedia:Allergen chebi_ontology alergeno allergene allergenic agent CHEBI:50904 allergen alergeno ChEBI alergeno chebi allergene ChEBI allergene chebi allergenic agent ChEBI allergenic agent chebi A role is particular behaviour which a material entity may exhibit. chebi_ontology CHEBI:50906 role A poison that interferes with the functions of the nervous system. CHEBI:50911 Wikipedia:Neurotoxin chebi_ontology agente neurotoxico nerve poison nerve poisons neurotoxic agent neurotoxic agents neurotoxicant neurotoxins CHEBI:50910 neurotoxin agente neurotoxico ChEBI agente neurotoxico chebi nerve poison ChEBI nerve poison chebi nerve poisons ChEBI nerve poisons chebi neurotoxic agent ChEBI neurotoxic agent chebi neurotoxic agents ChEBI neurotoxic agents chebi neurotoxicant ChEBI neurotoxicant chebi neurotoxins ChEBI neurotoxins chebi Systems consisting of two or more molecular entities held together by non-covalent interactions. chebi_ontology non-covalently-bound molecular entities CHEBI:50967 non-covalently-bound molecular entity non-covalently-bound molecular entities ChEBI non-covalently-bound molecular entities chebi A compound formally derived from ammonia by replacing one hydrogen atom by an organyl group. chebi_ontology primary amino compounds CHEBI:50994 primary amino compound primary amino compounds ChEBI primary amino compounds chebi A compound formally derived from ammonia by replacing three hydrogen atoms by organyl groups. chebi_ontology tertiary amino compounds CHEBI:50996 tertiary amino compound tertiary amino compounds chebi A chemical substance which binds to specific hormone receptors activating the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites. chebi_ontology CHEBI:51060 hormone agonist A drug that modulates the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites. chebi_ontology hormone receptor modulators CHEBI:51061 hormone receptor modulator hormone receptor modulators ChEBI hormone receptor modulators chebi A role played by the molecular entity or part thereof within a chemical context. chebi_ontology CHEBI:51086 chemical role CHEBI:25556 CHEBI:7594 KEGG:C06061 chebi_ontology Nitrogenous compounds nitrogen compounds nitrogen molecular entities CHEBI:51143 nitrogen molecular entity Nitrogenous compounds KEGG_COMPOUND Nitrogenous compounds kegg.compound nitrogen compounds ChEBI nitrogen compounds chebi nitrogen molecular entities ChEBI nitrogen molecular entities chebi An organic molecule that is electrically neutral carrying a positive and a negative charge in one of its major canonical descriptions. In most dipolar compounds the charges are delocalized; however the term is also applied to species where this is not the case. chebi_ontology dipolar compounds CHEBI:51151 dipolar compound dipolar compounds ChEBI dipolar compounds chebi An agent that suppresses cough. Antitussives have a central or a peripheral action on the cough reflex, or a combination of both. Compare with <em>expectorants</em>, which are considered to increase the volume of secretions in the respiratory tract, so facilitating their removal by ciliary action and coughing, and <em>mucolytics</em>, which decrease the viscosity of mucus, facilitating its removal by ciliary action and expectoration. chebi_ontology anti-tussive cough suppressant cough suppressants CHEBI:51177 antitussive anti-tussive chebi cough suppressant chebi cough suppressants chebi A substance, such as agonists, antagonists, degradation or uptake inhibitors, depleters, precursors, and modulators of receptor function, used for its pharmacological actions on GABAergic systems. chebi_ontology CHEBI:51374 GABA agent chebi_ontology D-lyxoascorbic acid D-threo-hex-2-enoic acid gamma-lactone D-xyloascorbic acid CHEBI:51384 D-ascorbic acid D-lyxoascorbic acid chebi D-threo-hex-2-enoic acid gamma-lactone chebi D-xyloascorbic acid chebi Any organic substituent group, regardless of functional type, having two free valences at carbon atom(s). chebi_ontology organodiyl groups CHEBI:51422 organodiyl group organodiyl groups ChEBI organodiyl groups chebi chebi_ontology CHEBI:51446 organic divalent group chebi_ontology organic monovalent group CHEBI:51447 organic univalent group organic monovalent group chebi A carboxamide resulting from the formal condensation of a carboxylic acid with the amino group of an amino acid. CHEBI:21653 CHEBI:22226 chebi_ontology N-acyl amino acid N-acyl amino acids N-acyl-amino-acid N-acyl-amino-acids N-acylamino acid N-acylamino acids acyl-amino-acid acyl-amino-acids acylamino acids CHEBI:51569 N-acyl-amino acid N-acyl amino acid chebi N-acyl amino acids chebi N-acyl-amino-acid chebi N-acyl-amino-acids chebi N-acylamino acid chebi N-acylamino acids chebi acyl-amino-acid chebi acyl-amino-acids chebi acylamino acids chebi An alpha,beta-unsaturated ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) in which the C=O function is conjugated to a C=C double bond at the alpha,beta position. An α,β-unsaturated ketone of general formula R<small>^1</small>R<small>^2</small>C=CR<small>^3</small>‒C(=O)R<small>^4</small> (R<small>^4</small> ≠ H) in which the C=O function is conjugated to a C=C double bond at the α,β position. Wikipedia:Enone chebi_ontology enones CHEBI:51689 enone enones ChEBI enones chebi A ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) or R(1)C#C-C(=O)R(2) (R(2) =/= H) in which the ketonic C=O function is conjugated to an unsaturated C-C bond at the alpha,beta position. A ketone of general formula R<small>^1</small>R<small>^2</small>C=CR<small>^3</small>‒C(=O)R<small>^4</small> (R<small>^4</small> ≠ H) or R<small>^1</small>C≡C‒C(=O)R<small>^2</small> (R<small>^2</small> ≠ H) in which the ketonic C=O function is conjugated to an unsaturated C-C bond at the α,β position. chebi_ontology alpha,beta-unsaturated ketones CHEBI:51721 alpha,beta-unsaturated ketone alpha,beta-unsaturated ketones ChEBI alpha,beta-unsaturated ketones chebi chebi_ontology organic polycyclic compounds CHEBI:51958 organic polycyclic compound organic polycyclic compounds ChEBI organic polycyclic compounds chebi An organic anion that is the conjugate base of methanol. chebi_ontology methoxide ion CHEBI:52090 methoxide methoxide ion chebi A biological role played by the molecular entity or part thereof within a biochemical context. chebi_ontology CHEBI:52206 biochemical role A role played by the molecular entity or part thereof which causes the development of a pathological process. chebi_ontology etiopathogenetic agent etiopathogenetic role CHEBI:52209 aetiopathogenetic role etiopathogenetic agent ChEBI etiopathogenetic agent chebi etiopathogenetic role ChEBI etiopathogenetic role chebi A biological role which describes how a drug interacts within a biological system and how the interactions affect its medicinal properties. chebi_ontology CHEBI:52210 pharmacological role A biological role relating to the normal mechanisms and their interactions within a living system. chebi_ontology CHEBI:52211 physiological role Any molecule or ion capable of binding to a central metal atom to form coordination complexes. chebi_ontology ligands CHEBI:52214 ligand ligands chebi Any substance introduced into a living organism with therapeutic or diagnostic purpose. CHEBI:33293 CHEBI:33294 chebi_ontology farmaco medicament pharmaceuticals CHEBI:52217 pharmaceutical farmaco ChEBI farmaco chebi medicament ChEBI medicament chebi pharmaceuticals ChEBI pharmaceuticals chebi A phosphate mineral with the general formula Ca5(PO4)3X where X = OH, F or Cl. HMDB:HMDB0033610 hydroxyapatite CHEBI:52254 apatite hydroxyapatite ChEBI A phosphate mineral with the formula Ca5(PO4)3(OH). CHEBI:52255 hydroxylapatite A chemical substance that encourages a cell to commence cell division, triggering mitosis. chebi_ontology mitogens CHEBI:52290 mitogen mitogens chebi A glycolipid and which the glyco component is specified as galactosyl. chebi_ontology CHEBI:5254 galactolipid A glycerol ether having at least one alkyl substituent on oxygen. chebi_ontology O-alkylglycerol O-alkylglycerols alkylglycerols CHEBI:52575 alkylglycerol O-alkylglycerol chebi O-alkylglycerols chebi alkylglycerols chebi chebi_ontology inorganic hydroxides CHEBI:52625 inorganic hydroxy compound inorganic hydroxides ChEBI inorganic hydroxides chebi An ethanolamine substituted at nitrogen by an acyl group. CHEBI:50870 CHEBI:52579 chebi_ontology N-acylethanolamines acylethanolamide acylethanolamides an N-acylethanolamine CHEBI:52640 N-acylethanolamine N-acylethanolamines chebi acylethanolamide chebi acylethanolamides chebi an N-acylethanolamine uniprot_ft An organic group that consists of a closed ring. It may be a substituent or a skeleton. chebi_ontology cyclic organic groups CHEBI:52845 cyclic organic group cyclic organic groups ChEBI cyclic organic groups chebi The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds. chebi_ontology antigenic determinant epitope function epitope role CHEBI:53000 epitope antigenic determinant ChEBI antigenic determinant chebi epitope function ChEBI epitope function chebi epitope role ChEBI epitope role chebi A halophenol in which the halogen atom is bonded to the carbon atom adjacent to the C‒OH group. chebi_ontology 2-halophenols CHEBI:53291 2-halophenol 2-halophenols chebi The amino acid zwitterion formed from 3,3',5-triiodo-<small>L</small>-thyronine by tranfer of a proton from the carboxy group to the amino group. It is the major species at pH 7.3. chebi_ontology (S)-2-Amino-3-[4-(4-hydroxy-3-iodo-phenoxy)-3,5-diiodo-phenyl]-propionic acid 3,3',5-triiodo-L-thyronine CHEBI:533015 3,3',5-triiodo-L-thyronine zwitterion (S)-2-Amino-3-[4-(4-hydroxy-3-iodo-phenoxy)-3,5-diiodo-phenyl]-propionic acid chembl 3,3',5-triiodo-L-thyronine uniprot_ft A polymer carrying multiple negative charges. chebi_ontology polyanion polyanions CHEBI:53309 polyanionic macromolecule polyanion ChEBI polyanion chebi polyanions SUBMITTER polyanions submitter Any fatty acid containing at least one C=C double bond. chebi_ontology CHEBI:53339 olefinic fatty acid A macromolecule containing ionic groups. chebi_ontology ionic polymer polyionic macromolecule CHEBI:53368 ionic macromolecule ionic polymer ChEBI ionic polymer chebi polyionic macromolecule ChEBI polyionic macromolecule chebi chebi_ontology Globin globins CHEBI:5386 globin Globin kegg.compound globins chebi A 29-amino acid peptide hormone consisting of His, Ser, Gln, Gly, Thr, Phe, Thr, Ser, Asp, Tyr, Ser, Lys, Tyr, Leu, Asp, Ser, Arg, Arg, Ala, Gln, Asp, Phe, Val, Gln, Trp, Leu, Met, Asn and Thr residues joined in sequence. DrugBank:DB00040 KEGG:C01501 KEGG:D00116 Wikipedia:Glucagon Glucagon Glucagone HSQGTFTSDYSKYLDSRRAQDFVQWLMNT His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr CHEBI:5391 glucagon Glucagon KEGG_COMPOUND Glucagone ChemIDplus HSQGTFTSDYSKYLDSRRAQDFVQWLMNT ChEBI His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr ChEBI His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr ChemIDplus A compound that exhibits agonist activity at the μ-opioid receptor. CHEBI:50136 chebi_ontology mu opioid agonist mu-opioid agonists mu-opioid receptor agonists CHEBI:55322 mu-opioid receptor agonist mu opioid agonist chebi mu-opioid agonists chebi mu-opioid receptor agonists chebi An imidazolidine containing one or more oxo groups. chebi_ontology imidazolidinones CHEBI:55370 imidazolidinone imidazolidinones chebi A dialdehyde that is propane substituted by two oxo groups at the terminal carbon atoms respectively. A biomarker of oxidative damage to lipids caused by smoking, it exists <em>in vivo</em> mainly in the enol form. CHEBI:43895 chebi_ontology 1,3-Propanedial 1,3-Propanedialdehyde 1,3-Propanedione MDA MDD Malondialdehyde Malonic aldehyde Malonic dialdehyde Malonodialdehyde Malonyldialdehyde malonaldehyde CHEBI:566274 malonaldehyde 1,3-Propanedial chemidplus 1,3-Propanedialdehyde chemidplus 1,3-Propanedione chemidplus MDA chebi MDD chebi Malondialdehyde chemidplus kegg.compound Malonic aldehyde chemidplus Malonic dialdehyde chemidplus Malonodialdehyde chemidplus Malonyldialdehyde chemidplus malonaldehyde uniprot_ft A cyclic compound having as ring members atoms of at least two different elements. Heterocyclic compound chebi_ontology Heterocyclic compound compuesto heterociclico compuestos heterociclicos heterocycle heterocyclic compounds CHEBI:5686 heterocyclic compound Heterocyclic compound KEGG_COMPOUND Heterocyclic compound kegg.compound compuesto heterociclico IUPAC compuesto heterociclico iupac compuestos heterociclicos IUPAC compuestos heterociclicos iupac heterocycle ChEBI heterocycle chebi heterocyclic compounds ChEBI heterocyclic compounds chebi A ribonucleoside triphosphate oxoanion that is the trianion of adenosine 5'-triphosphate arising from deprotonation of three of the four free triphosphate OH groups. chebi_ontology CHEBI:57299 ATP(3-) An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of glycine. chebi_ontology glycine CHEBI:57305 glycine zwitterion glycine uniprot_ft A fatty acid anion with a chain length of C<small>₁₃</small> to C<small>₂₂</small>. CHEBI:13652 chebi_ontology a long-chain carboxylate a long-chain fatty acid long-chain fatty acid anions CHEBI:57560 long-chain fatty acid anion a long-chain carboxylate chebi a long-chain fatty acid uniprot_ft long-chain fatty acid anions chebi A primary aliphatic ammonium ion that is the conjugate acid of ethanolamine arising from protonation of the primary amino function. chebi_ontology 2-hydroxyethan-1-aminium ethanolamine ethanolaminium cation CHEBI:57603 ethanolaminium(1+) 2-hydroxyethan-1-aminium chebi ethanolamine uniprot_ft ethanolaminium cation chebi Zwitterionic form of γ-amino-β-hydroxybutyric acid having an anionic carboxy group and a protonated amino group. chebi_ontology 4-amino-3-hydroxybutanoate 4-ammonio-3-hydroxybutanoate CHEBI:57630 gamma-amino-beta-hydroxybutyric acid zwitterion 4-amino-3-hydroxybutanoate uniprot_ft 4-ammonio-3-hydroxybutanoate chebi Anionic form of chondroitin D-glucuronate arising from deprotonation of the carboxylic acid groups of the repeating units; major species at pH 7.3. chondroitin D-glucuronate chondroitin D-glucuronate polyanion CHEBI:57652 chondroitin D-glucuronate anion chondroitin D-glucuronate UniProt chondroitin D-glucuronate polyanion ChEBI The cationic sphingoid resulting from the protonation of the amino group of sphingosine. chebi_ontology sphing-4-enine CHEBI:57756 sphingosine(1+) sphing-4-enine uniprot_ft A dicarboxylic acid dianion that is the conjugate base of prephenic acid; major species at pH 7.3. prephenate prephenate dianion CHEBI:57852 prephenate(2-) prephenate ChEBI prephenate dianion ChEBI The conjugate base of a nucleoside 5'-phosphate. chebi_ontology a nucleoside 5'-phosphate nucleoside 5'-phosphate dianions CHEBI:57867 nucleoside 5'-phosphate dianion a nucleoside 5'-phosphate UniProt a nucleoside 5'-phosphate uniprot_ft nucleoside 5'-phosphate dianions ChEBI nucleoside 5'-phosphate dianions chebi An ammonium ion that is the conjugate acid of tryptamine arising from protonation of the primary amino group; major species at pH 7.3. chebi_ontology tryptamine tryptaminium cation tryptaminium(1+) CHEBI:57887 tryptaminium tryptamine UniProt tryptamine uniprot_ft tryptaminium cation ChEBI tryptaminium cation chebi tryptaminium(1+) ChEBI tryptaminium(1+) chebi A peptide anion obtained by deprotonation of both carboxy groups and protonation of the glutamyl amino group of glutathione; major species at pH 7.3. chebi_ontology glutathionate glutathionate anion glutathionate ion glutathione CHEBI:57925 glutathionate(1-) glutathionate chebi glutathionate anion chebi glutathionate ion chebi glutathione uniprot_ft Trianion of nucleoside diphosphate arising from deprotonation of all three free OH groups of the diphosphate; major species at pH 7.3. chebi_ontology NDP trianion NDP(3-) a ribonucleoside 5'-diphosphate nucleoside diphosphate trianion ribonucleoside diphosphate trianion ribonucleoside diphosphate(3-) CHEBI:57930 nucleoside 5'-diphosphate(3-) NDP trianion ChEBI NDP trianion chebi NDP(3-) ChEBI NDP(3-) chebi a ribonucleoside 5'-diphosphate UniProt a ribonucleoside 5'-diphosphate uniprot_ft nucleoside diphosphate trianion ChEBI nucleoside diphosphate trianion chebi ribonucleoside diphosphate trianion ChEBI ribonucleoside diphosphate trianion chebi ribonucleoside diphosphate(3-) ChEBI ribonucleoside diphosphate(3-) chebi Zwitterionic form of creatine arising from transfer of a proton from the carboxy to the guanidino group; major species at pH 7.3. chebi_ontology creatine CHEBI:57947 creatine zwitterion creatine uniprot_ft Zwitterionic form of β-alanine arising from transfer of a proton from the carboxy to the amino group; major species at pH 7.3. chebi_ontology 3-ammoniopropanoate beta-alanine CHEBI:57966 beta-alanine zwitterion 3-ammoniopropanoate iupac beta-alanine uniprot_ft A dicarboxylic acid dianion obtained by deprotonation of the two carboxy groups of bilirubin; major species at pH 7.3. chebi_ontology (4Z,15Z)-bilirubin IX-alpha (4Z,15Z)-bilirubin IXalpha 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate bilirubin dianion CHEBI:57977 bilirubin(2-) (4Z,15Z)-bilirubin IX-alpha uniprot_ft (4Z,15Z)-bilirubin IXalpha UniProt 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate ChEBI 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate chebi bilirubin dianion ChEBI bilirubin dianion chebi A D-alpha-amino acid zwitterion that is D-phenylalanine in which a proton has been transferred from the carboxy group to the amino group. It is the major species at pH 7.3. MetaCyc:CPD-216 (2R)-2-ammonio-3-phenylpropanoate D-phenylalanine CHEBI:57981 D-phenylalanine zwitterion (2R)-2-ammonio-3-phenylpropanoate IUPAC D-phenylalanine UniProt The conjugate acid of a primary aliphatic amine. chebi_ontology an aliphatic amine primary aliphatic ammonium cation primary aliphatic ammonium cations primary aliphatic ammonium ions CHEBI:58001 primary aliphatic ammonium ion an aliphatic amine uniprot_ft primary aliphatic ammonium cation chebi primary aliphatic ammonium cations chebi primary aliphatic ammonium ions chebi An amino acid zwitterion of homocysteine arising from transfer of a proton from the carboxy to the amino group; major species at pH 7.3. chebi_ontology 2-ammonio-4-sulfanylbutanoate CHEBI:58065 homocysteine zwitterion 2-ammonio-4-sulfanylbutanoate chebi An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of L-phenylalanine; major species at pH 7.3. MetaCyc:PHE (2S)-2-ammonio-3-phenylpropanoate L-phenylalanine phenylalanine CHEBI:58095 L-phenylalanine zwitterion (2S)-2-ammonio-3-phenylpropanoate IUPAC L-phenylalanine UniProt phenylalanine ChEBI Trianion of nucleoside triphosphate arising from deprotonation of three of the four free triphosphate OH groups. chebi_ontology NTP trianion NTP(3-) nucleoside triphosphate trianion ribonucleoside triphosphate trianion ribonucleoside triphosphate(3-) CHEBI:58104 nucleoside 5'-triphoshate(3-) NTP trianion ChEBI NTP trianion chebi NTP(3-) ChEBI NTP(3-) chebi nucleoside triphosphate trianion ChEBI nucleoside triphosphate trianion chebi ribonucleoside triphosphate trianion ChEBI ribonucleoside triphosphate trianion chebi ribonucleoside triphosphate(3-) ChEBI ribonucleoside triphosphate(3-) chebi A hydroxy monocarboxylic acid anion where the hydroxy group is placed at position 2 (α to the carboxy group) and has (<i>S</i>)-stereochemistry; major species at pH 7.3. CHEBI:61394 CHEBI:70794 chebi_ontology (2S)-2-hydroxy monocarboxylate (2S)-2-hydroxy monocarboxylates (2S)-2-hydroxy monocarboxylic acid anions (2S)-2-hydroxycarboxylate (2S)-alpha-hydroxy monocarboxylic acid anion (2S)-alpha-hydroxy monocarboxylic acid anions (S)-2-hydroxyacid anion (S)-2-hydroxyacid anions a (2S)-2-hydroxycarboxylate CHEBI:58123 (2S)-2-hydroxy monocarboxylic acid anion (2S)-2-hydroxy monocarboxylate chebi (2S)-2-hydroxy monocarboxylates chebi (2S)-2-hydroxy monocarboxylic acid anions chebi (2S)-2-hydroxycarboxylate chebi (2S)-alpha-hydroxy monocarboxylic acid anion chebi (2S)-alpha-hydroxy monocarboxylic acid anions chebi (S)-2-hydroxyacid anion chebi (S)-2-hydroxyacid anions chebi a (2S)-2-hydroxycarboxylate uniprot_ft A hydroxy monocarboxylic acid anion where the hydroxy group is placed at position 2 (α to the carboxy group) and has (<i>R</i>)-stereochemistry; major species at pH 7.3. chebi_ontology (2R)-2-hydroxy monocarboxylic acid anions (2R)-2-hydroxycarboxylate (2R)-alpha-hydroxy monocarboxylic acid anion (2R)-alpha-hydroxy monocarboxylic acid anions (R)-2-hydroxyacid anion (R)-2-hydroxyacid anions a (2R)-2-hydroxycarboxylate CHEBI:58314 (2R)-2-hydroxy monocarboxylic acid anion (2R)-2-hydroxy monocarboxylic acid anions chebi (2R)-2-hydroxycarboxylate chebi (2R)-alpha-hydroxy monocarboxylic acid anion chebi (2R)-alpha-hydroxy monocarboxylic acid anions chebi (R)-2-hydroxyacid anion chebi (R)-2-hydroxyacid anions chebi a (2R)-2-hydroxycarboxylate uniprot_ft An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of L-tyrosine; major species at pH 7.3. (2S)-2-ammonio-3-(4-hydroxyphenyl)propanoate L-tyrosine CHEBI:58315 L-tyrosine zwitterion (2S)-2-ammonio-3-(4-hydroxyphenyl)propanoate IUPAC L-tyrosine UniProt An ammonium ion that is the conjugate acid of trimethylamine, obtained via protonation of the nitrogen; major species at pH 7.3. chebi_ontology trimethylamine trimethylammonium cation trimethylazanium trimethylazanium cation CHEBI:58389 trimethylammonium trimethylamine uniprot_ft trimethylammonium cation chebi trimethylazanium chebi trimethylazanium cation chebi An ammonium ion that is the conjugate acid of histamine protonated on the side-chain nitrogen. chebi_ontology histamine histaminium cation CHEBI:58432 histaminium histamine UniProt histamine uniprot_ft histaminium cation ChEBI histaminium cation chebi The conjugate base of an <em>N</em>-acetyl-<small>D</small>-amino acid. chebi_ontology N-acetyl-D-amino acetate(1-) N-acetyl-D-amino acid anions N-acetyl-D-amino carboxylate anions an N-acetyl-D-amino acid CHEBI:58496 N-acetyl-D-amino acid anion N-acetyl-D-amino acetate(1-) chebi N-acetyl-D-amino acid anions chebi N-acetyl-D-amino carboxylate anions chebi an N-acetyl-D-amino acid uniprot_ft Conjugate base of an <em>N</em>-acyl-<small>L</small>-aspartic acid. chebi_ontology an N-acyl-L-aspartate CHEBI:58497 N-acyl-L-aspartate(2-) an N-acyl-L-aspartate uniprot_ft A D-alpha-amino acid zwitterion that is D-tyrosine in which a proton has been transferred from the carboxy group to the amino group. It is the major species at pH 7.3. MetaCyc:D-TYROSINE D-tyrosine CHEBI:58570 D-tyrosine zwitterion D-tyrosine UniProt An amino-acid residue protonated on nitrogen. chebi_ontology amino acid cation residue amino acid cation residues amino-acid cation residue amino-acid cation residues cationic amino acid residue cationic amino acid residues cationic amino-acid residues CHEBI:58942 cationic amino-acid residue amino acid cation residue ChEBI amino acid cation residue chebi amino acid cation residues ChEBI amino acid cation residues chebi amino-acid cation residue ChEBI amino-acid cation residue chebi amino-acid cation residues ChEBI amino-acid cation residues chebi cationic amino acid residue ChEBI cationic amino acid residue chebi cationic amino acid residues ChEBI cationic amino acid residues chebi cationic amino-acid residues ChEBI cationic amino-acid residues chebi An organic phosphoric acid derivative in which one or more oxygen atoms of the phosphate group(s) has been deprotonated. chebi_ontology organophosphate oxoanions CHEBI:58945 organophosphate oxoanion organophosphate oxoanions ChEBI organophosphate oxoanions chebi Any fatty acid anion obtained by removal of a proton from the carboxy group of a short-chain fatty acid (chain length of less than C6). Any fatty acid anion obtained by removal of a proton from the carboxy group of a short-chain fatty acid (chain length of less than C<small>₆</small>). chebi_ontology a short-chain fatty acid short-chain fatty acid anions CHEBI:58951 short-chain fatty acid anion a short-chain fatty acid UniProt a short-chain fatty acid uniprot_ft short-chain fatty acid anions ChEBI short-chain fatty acid anions chebi Any fatty acid anion in which there is no C-C unsaturation. Any fatty acid anion in which there is no C‒C unsaturation. chebi_ontology saturated fatty acid anions CHEBI:58953 saturated fatty acid anion saturated fatty acid anions ChEBI saturated fatty acid anions chebi Any saturated fatty acid anion lacking a carbon side-chain. chebi_ontology straight-chain saturated fatty acid anions CHEBI:58954 straight-chain saturated fatty acid anion straight-chain saturated fatty acid anions ChEBI straight-chain saturated fatty acid anions chebi An organic anion of general formula RS(=O)2O(-) where R is an organyl group. An organic anion of general formula RS(=O)2O(−) where R is an organyl group. chebi_ontology organosulfate oxoanions CHEBI:58958 organosulfate oxoanion organosulfate oxoanions ChEBI organosulfate oxoanions chebi Any substance that stimulates an immune response in the body, such as through antibody production or by presentation to a T-cell receptor after binding to a major histocompability complex (MHC). antigens CHEBI:59132 antigen antigens ChEBI A substance used as an indicator of a biological state. chebi_ontology biological marker CHEBI:59163 biomarker biological marker chebi Any substance capable of eliciting an immune response only when attached to a large carrier such as a protein. Examples include dinitrophenols; oligosaccharides; peptides; and heavy metals. chebi_ontology haptens CHEBI:59174 hapten haptens chebi Any fatty acid whose skeletal carbon atoms form an unbranched open chain. chebi_ontology straight-chain fatty acids CHEBI:59202 straight-chain fatty acid straight-chain fatty acids ChEBI straight-chain fatty acids chebi A fatty acid anion formed by deprotonation of the carboxylic acid functional group of a straight-chain fatty acid. chebi_ontology straight-chain FA anion straight-chain FA anions straight-chain fatty acid anions CHEBI:59203 straight-chain fatty acid anion straight-chain FA anion ChEBI straight-chain FA anion chebi straight-chain FA anions ChEBI straight-chain FA anions chebi straight-chain fatty acid anions ChEBI straight-chain fatty acid anions chebi Any fatty acid containing anywhere in its structure a ring of atoms. chebi_ontology acides gras cycliques acidos grasos ciclicos cyclic fatty acids zyklische Fettsaeuren CHEBI:59238 cyclic fatty acid acides gras cycliques chebi acidos grasos ciclicos chebi cyclic fatty acids chebi zyklische Fettsaeuren chebi An organic anion arising from deprotonation of a acyclic tetrapyrrole compound. chebi_ontology acyclic tetrapyrrole anion acyclic tetrapyrrole anions linear tetrapyrrole anions CHEBI:59252 linear tetrapyrrole anion acyclic tetrapyrrole anion ChEBI acyclic tetrapyrrole anion chebi acyclic tetrapyrrole anions ChEBI acyclic tetrapyrrole anions chebi linear tetrapyrrole anions ChEBI linear tetrapyrrole anions chebi A prostanoid anion obtained by deprotonation of the carboxy group of any prostaglandin. chebi_ontology prostaglandin carboxylic acid anions CHEBI:59326 prostaglandin carboxylic acid anion prostaglandin carboxylic acid anions chebi Any member of the sub-set of polyunsaturated fatty acid for which there is an absolute dietary requirement. chebi_ontology EFA EFAs EFS acides gras indispensables acidos grasos esenciales essential fatty acids essentielle Fettsaeuren CHEBI:59549 essential fatty acid EFA chebi EFAs chebi EFS chebi acides gras indispensables chebi acidos grasos esenciales chebi essential fatty acids chebi essentielle Fettsaeuren chebi Any fatty acid with a chain length of between C<small>₆</small> and C<small>₁₂</small>. chebi_ontology MCFA MCFAs medium-chain fatty acids CHEBI:59554 medium-chain fatty acid MCFA chebi MCFAs chebi medium-chain fatty acids chebi A fatty acid anion resulting from the deprotonation of the carboxylic acid moiety of a medium-chain fatty acid. chebi_ontology MCFA anion MCFA anions a medium-chain fatty acid medium-chain FA anion medium-chain FA anions medium-chain fatty acid anions CHEBI:59558 medium-chain fatty acid anion MCFA anion chebi MCFA anions chebi a medium-chain fatty acid uniprot_ft medium-chain FA anion chebi medium-chain FA anions chebi medium-chain fatty acid anions chebi An organic anion that is the conjugate base of diamino acid. chebi_ontology diamino acid anions CHEBI:59561 diamino acid anion diamino acid anions chebi Compounds containing one or more phosphoric acid units. chebi_ontology CHEBI:59698 phosphoric acids An anion arising from deprotonation of the carboxylic acid function of any mono-hydroperoxy (e)icosatetraenoic acid (HPETE) chebi_ontology HPETE anions a hydroperoxyeicosatetraenoate hydroperoxyeicosatetraenoate hydroperoxyeicosatetraenoates CHEBI:59720 HPETE anion HPETE anions chebi a hydroperoxyeicosatetraenoate uniprot_ft hydroperoxyeicosatetraenoate chebi hydroperoxyeicosatetraenoates chebi An organophosphate anion resulting from deprotonation of at least one of the acidic hydroxy groups from the triphosphate moiety of a nucleoside triphosphate. chebi_ontology ribonucleoside triphosphate anion ribonucleoside triphosphate anions ribonucleoside triphosphate oxoanions CHEBI:59724 ribonucleoside triphosphate oxoanion ribonucleoside triphosphate anion ChEBI ribonucleoside triphosphate anion chebi ribonucleoside triphosphate anions ChEBI ribonucleoside triphosphate anions chebi ribonucleoside triphosphate oxoanions ChEBI ribonucleoside triphosphate oxoanions chebi A reagent that forms a bond to its reaction partner (the electrophile) by donating both bonding electrons. chebi_ontology nucleophile nucleophiles nucleophilic reagents CHEBI:59740 nucleophilic reagent nucleophile ChEBI nucleophile chebi nucleophiles ChEBI nucleophiles chebi nucleophilic reagents ChEBI nucleophilic reagents chebi Conjugate base of an <small>L</small>-α-amino acid arising from deprotonation of the C-1 carboxy group. Conjugate base of an L-alpha-amino acid arising from deprotonation of the C-1 carboxy group. chebi_ontology L-alpha-amino carboxylate CHEBI:59814 L-alpha-amino acid anion L-alpha-amino carboxylate ChEBI L-alpha-amino carboxylate chebi A synthetic progestogen. Wikipedia:Progestin chebi_ontology progestins CHEBI:59826 progestin progestins ChEBI progestins chebi Zwitterionic form of an <small>L</small>-α-amino acid having an anionic carboxy group and a protonated amino group. Zwitterionic form of an L-alpha-amino acid having an anionic carboxy group and a protonated amino group. chebi_ontology L-alpha-amino acid zwitterions an L-alpha-amino acid CHEBI:59869 L-alpha-amino acid zwitterion L-alpha-amino acid zwitterions ChEBI L-alpha-amino acid zwitterions chebi an L-alpha-amino acid UniProt an L-alpha-amino acid uniprot_ft Zwitterionic form of a <small>D</small>-α-amino acid having an anionic carboxy group and a protonated amino group. Zwitterionic form of a D-alpha-amino acid having an anionic carboxy group and a protonated amino group. chebi_ontology D-alpha-amino acid zwitterions a D-alpha-amino acid CHEBI:59871 D-alpha-amino acid zwitterion D-alpha-amino acid zwitterions ChEBI D-alpha-amino acid zwitterions chebi a D-alpha-amino acid UniProt a D-alpha-amino acid uniprot_ft A carboxylic acid anion that is the conjugate base of an <em>N</em>-acyl-<small>L</small>-α-amino acid arising from deprotonation of the C-1 carboxy group. chebi_ontology N-acyl-L-alpha-amino acid(1-) an N-acyl-L-amino acid CHEBI:59874 N-acyl-L-alpha-amino acid anion N-acyl-L-alpha-amino acid(1-) chebi an N-acyl-L-amino acid uniprot_ft The conjugate base of an <em>N</em>-acyl-<small>D</small>-α-amino acid arising from deprotonation of the C-1 carboxy group. chebi_ontology N-acyl-D-alpha-amino acid(1-) an N-acyl-D-amino acid CHEBI:59876 N-acyl-D-alpha-amino acid anion N-acyl-D-alpha-amino acid(1-) chebi an N-acyl-D-amino acid uniprot_ft Zwitterionic form of gamma-aminobutyric acid having an anionic carboxy group and a protonated amino group. Zwitterionic form of γ-aminobutyric acid having an anionic carboxy group and a protonated amino group. chebi_ontology 4-aminobutanoate 4-ammoniobutanoate CHEBI:59888 gamma-aminobutyric acid zwitterion 4-aminobutanoate UniProt 4-aminobutanoate uniprot_ft 4-ammoniobutanoate ChEBI 4-ammoniobutanoate chebi An ammonium ion that is the conjugate acid of dopamine; major species at pH 7.3. chebi_ontology 2-(3,4-dihydroxyphenyl)ethan-1-aminium dopamine dopaminium cation CHEBI:59905 dopaminium(1+) 2-(3,4-dihydroxyphenyl)ethan-1-aminium ChEBI 2-(3,4-dihydroxyphenyl)ethan-1-aminium chebi dopamine UniProt dopamine uniprot_ft dopaminium cation ChEBI dopaminium cation chebi The trialkylammonium ion resulting from the protonation of the amino group of thebaine. chebi_ontology thebaine CHEBI:59953 thebaine(1+) thebaine uniprot_ft A chemical substance is a portion of matter of constant composition, composed of molecular entities of the same type or of different types. chebi_ontology Chemische Substanz CHEBI:59999 chemical substance Chemische Substanz ChEBI Chemische Substanz chebi A mixture is a chemical substance composed of multiple molecules, at least two of which are of a different kind. chebi_ontology Mischung CHEBI:60004 mixture Mischung ChEBI Mischung chebi A polymer is a mixture, which is composed of macromolecules of different kinds and which may be differentiated by composition, length, degree of branching etc.. Wikipedia:Polymer Polymer chebi_ontology Kunststoff Polymer CHEBI:60027 polymer Polymer ChEBI Kunststoff ChEBI Kunststoff chebi Polymer chebi An ionic polymer is a polymer, composed of ionic macromolecules. chebi_ontology polyionic polymer CHEBI:60164 ionic polymer polyionic polymer ChEBI polyionic polymer chebi A cation formed by protonation of a peptide. chebi_ontology peptide cations CHEBI:60194 peptide cation peptide cations chebi A metal cation with a valence of two. a divalent metal cation CHEBI:60240 divalent metal cation a divalent metal cation UniProt An atom or small molecule with a positive charge that does not contain carbon in covalent linkage, with a valency of one. chebi_ontology a monovalent cation CHEBI:60242 monovalent inorganic cation a monovalent cation UniProt a monovalent cation uniprot_ft The anion resulting from the removal of the proton from the carboxylic acid group of 3,3',5-triiodo-<small>L</small>-thyronine. chebi_ontology (2S)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propionate 3,3',5-triiodo-L-thyronine anion 3,3',5-triiodo-L-thyronine(1-) liothyronine anion liothyronine(1-) CHEBI:60308 3,3',5-triiodo-L-thyroninate (2S)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propionate chebi 3,3',5-triiodo-L-thyronine anion chebi 3,3',5-triiodo-L-thyronine(1-) chebi liothyronine anion chebi liothyronine(1-) chebi Any hormone produced by the thyroid gland chebi_ontology thyroid hormones CHEBI:60311 thyroid hormone thyroid hormones chebi An anion formed by deprotonation of at least one peptide carboxy group. chebi_ontology peptide anions CHEBI:60334 peptide anion peptide anions chebi Zwitterionic form of any peptide where, in general, the amino terminus is positively charged and the carboxy terminus is negatively charged. chebi_ontology a peptide peptide zwitterions CHEBI:60466 peptide zwitterion a peptide UniProt a peptide uniprot_ft peptide zwitterions ChEBI peptide zwitterions chebi Any agent that acts on an opioid receptor or affects the life cycle of an opioid transmitter. chebi_ontology opioid agents CHEBI:60598 opioid agent opioid agents chebi Any agent that acts on a μ-opioid receptor. chebi_ontology mu-opioid agents CHEBI:60599 mu-opioid agent mu-opioid agents chebi An agent that selectively binds to and activates an opioid receptor. chebi_ontology opiate agonist opiate agonists opioid agonist opioid agonists opioid receptor agonists CHEBI:60606 opioid receptor agonist opiate agonist chebi opiate agonists chebi opioid agonist chebi opioid agonists chebi opioid receptor agonists chebi Any pharmacological or immunological agent that modifies the effect of other agents such as drugs or vaccines while having few if any direct effects when given by itself. adjuvants CHEBI:60809 adjuvant adjuvants ChEBI An antigen capable, on its own, of inducing an immune response. CHEBI:60816 immunogen Any alpha-amino acid anion in which the parent amino acid has D-configuration. Any α-amino acid anion in which the parent amino acid has <small>D</small>-configuration. chebi_ontology D-alpha-amino acid anions D-alpha-amino carboxylate CHEBI:60895 D-alpha-amino acid anion D-alpha-amino acid anions ChEBI D-alpha-amino acid anions chebi D-alpha-amino carboxylate ChEBI D-alpha-amino carboxylate chebi A racemate is an equimolar mixture of a pair of enantiomers. chebi_ontology melange racemique racemates racemic mixture CHEBI:60911 racemate melange racemique chebi racemates chebi racemic mixture chebi A sulfated glycosaminoglycan, a linear polymer that consists of the repeating disaccharide [3)-beta-Gal-(1->4)-beta-GlcNAc-(1->] and containing sulfo groups located at random positions. keratan sulfates keratosulfate CHEBI:60924 keratan sulfate keratan sulfates ChEBI keratosulfate SUBMITTER Any amino sugar that is a monosaccharide in which one alcoholic hydroxy group is replaced by an amino group. chebi_ontology amino monosaccharides CHEBI:60926 amino monosaccharide amino monosaccharides chebi Any lipid carrying one or more hydroperoxy substituents. chebi_ontology a lipid hydroperoxide lipid hydroperoxides CHEBI:61051 lipid hydroperoxide a lipid hydroperoxide uniprot_ft lipid hydroperoxides chebi An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the function of histone deacetylase (EC 3.5.1.98). Wikipedia:Histone_deacetylase_inhibitor chebi_ontology EC 3.5.1.98 (histone deacetylase) inhibitors EC 3.5.1.98 inhibitor EC 3.5.1.98 inhibitors HDAC inhibitor HDAC inhibitors HDACi HDACis HDI HDIs histone amidohydrolase inhibitor histone amidohydrolase inhibitors histone deacetylase (EC 3.5.1.98) inhibitor histone deacetylase (EC 3.5.1.98) inhibitors histone deacetylase inhibitor histone deacetylase inhibitors CHEBI:61115 EC 3.5.1.98 (histone deacetylase) inhibitor EC 3.5.1.98 (histone deacetylase) inhibitors ChEBI EC 3.5.1.98 (histone deacetylase) inhibitors chebi EC 3.5.1.98 inhibitor ChEBI EC 3.5.1.98 inhibitor chebi EC 3.5.1.98 inhibitors ChEBI EC 3.5.1.98 inhibitors chebi HDAC inhibitor ChEBI HDAC inhibitor chebi HDAC inhibitors ChEBI HDAC inhibitors chebi HDACi ChEBI HDACi chebi HDACis ChEBI HDACis chebi HDI ChEBI HDI chebi HDIs ChEBI HDIs chebi histone amidohydrolase inhibitor ChEBI histone amidohydrolase inhibitor chebi histone amidohydrolase inhibitors ChEBI histone amidohydrolase inhibitors chebi histone deacetylase (EC 3.5.1.98) inhibitor ChEBI histone deacetylase (EC 3.5.1.98) inhibitor chebi histone deacetylase (EC 3.5.1.98) inhibitors ChEBI histone deacetylase (EC 3.5.1.98) inhibitors chebi histone deacetylase inhibitor ChEBI histone deacetylase inhibitor chebi histone deacetylase inhibitors ChEBI histone deacetylase inhibitors chebi Any compound that has a nucleobase as a part. chebi_ontology nucleobase-containing compound nucleobase-containing compounds nucleobase-containing molecular entities CHEBI:61120 nucleobase-containing molecular entity nucleobase-containing compound SUBMITTER nucleobase-containing compound submitter nucleobase-containing compounds ChEBI nucleobase-containing compounds chebi nucleobase-containing molecular entities ChEBI nucleobase-containing molecular entities chebi A nucleotide having adenine as the base. chebi_ontology adenine nucleotide CHEBI:61293 adenyl nucleotide adenine nucleotide SUBMITTER A purine riboncleotide where adenine is the purine. chebi_ontology adenine ribonucleotide CHEBI:61296 adenyl ribonucleotide adenine ribonucleotide SUBMITTER adenine ribonucleotide submitter A steroid that has a structure based on a 21-carbon (pregnane) skeleton. Note that individual examples may have ring substituents at other positions and/or contain double bonds, aromatic A-rings, expanded/contracted rings etc., so the formula and mass may vary from that given for the generic structure. chebi_ontology a C(21)-steroid a C21-steroid CHEBI:61313 C21-steroid a C(21)-steroid uniprot_ft a C21-steroid UniProt A dicarboxylate that contains four carbon atoms. chebi_ontology CHEBI:61336 C4-dicarboxylate Any hydroxy carboxylic acid which contains a hydroxy group located β- to the carboxylic acid group. chebi_ontology 3-hydroxy carboxylic acids 3-hydroxycarboxylic acid 3-hydroxycarboxylic acids beta-hydroxy carboxylic acid beta-hydroxy carboxylic acids beta-hydroxycarboxylic acid beta-hydroxycarboxylic acids CHEBI:61355 3-hydroxy carboxylic acid 3-hydroxy carboxylic acids chebi 3-hydroxycarboxylic acid chebi 3-hydroxycarboxylic acids chebi beta-hydroxy carboxylic acid chebi beta-hydroxy carboxylic acids chebi beta-hydroxycarboxylic acid chebi beta-hydroxycarboxylic acids chebi A compound containing a sulfonic acid residue joined by a carbon‒sulfur bond to a lipid. chebi_ontology sulfolipids CHEBI:61384 sulfolipid sulfolipids chebi A polymer, composed of polyanion macromolecules. chebi_ontology polyanion polyanions CHEBI:61469 polyanionic polymer polyanion ChEBI polyanion chebi polyanions ChEBI polyanions chebi A ribonucleoside triphosphate oxoanion arising from global deprotonation of the triphosphate groups of any nucleoside triphosphate; major species at pH 7.3. chebi_ontology NTP tetraanion NTP(4-) a ribonucleoside 5'-triphosphate nucleoside 5'-triphosphate tetraanion nucleoside triphosphate(4-) CHEBI:61557 nucleoside 5'-triphoshate(4-) NTP tetraanion ChEBI NTP tetraanion chebi NTP(4-) SUBMITTER NTP(4-) submitter a ribonucleoside 5'-triphosphate UniProt a ribonucleoside 5'-triphosphate uniprot_ft nucleoside 5'-triphosphate tetraanion ChEBI nucleoside 5'-triphosphate tetraanion chebi nucleoside triphosphate(4-) ChEBI nucleoside triphosphate(4-) chebi Any organic molecular entity derived from a fatty acid. chebi_ontology FA derivative FA derivatives fatty acid derivatives CHEBI:61697 fatty acid derivative FA derivative chebi FA derivatives chebi fatty acid derivatives chebi An alpha-amino-acid residue derived from O(4)-phospho-L-tyrosine. O(4)-phosphotyrosine residue O-phospho-L-tyrosine residue O-phosphotyrosine residue CHEBI:61972 O(4)-phospho-L-tyrosine residue O(4)-phosphotyrosine residue ChEBI O-phospho-L-tyrosine residue ChEBI O-phosphotyrosine residue ChEBI An alpha-amino-acid residue anion obtained by deprotonation of the phosphate OH groups of O(4)-phospho-L-tyrosine residue; major speices at pH 7.3. CHEBI:82620 L-tyrosine-O-phosphate(2-) residue L-tyrosine-phosphate residue CHEBI:61978 O(4)-phosphonato-L-tyrosine(2-) residue L-tyrosine-O-phosphate(2-) residue ChEBI L-tyrosine-phosphate residue UniProt Zwitterionic form of a polar amino acid having an anionic carboxy group and a protonated amino group. chebi_ontology a polar amino acid CHEBI:62031 polar amino acid zwitterion a polar amino acid UniProt a polar amino acid uniprot_ft An alkanesulfonate in which the carbon at position 1 is attached to at least two hydrogens. chebi_ontology 1,1-di-unsubstituted alkanesulfonate 1,1-di-unsubstituted alkanesulfonates 1,1-diunsubstituted alkanesulfonates CHEBI:62081 1,1-diunsubstituted alkanesulfonate 1,1-di-unsubstituted alkanesulfonate chebi 1,1-di-unsubstituted alkanesulfonates chebi 1,1-diunsubstituted alkanesulfonates chebi An optically active form of O(4)-phosphonatotyrosine(2-) having L-configuration. (2S)-2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate 4-O-phospho-L-tyrosine O-phospho-L-tyrosine(2-) O-phosphono-L-tyrosine(2-) O-phosphotyrosine(2-) phosphonotyrosine(2-) phosphotyrosine(2-) tyrosine phosphate(2-) CHEBI:62338 O(4)-phosphonato-L-tyrosine(2-) (2S)-2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate IUPAC 4-O-phospho-L-tyrosine UniProt O-phospho-L-tyrosine(2-) SUBMITTER O-phosphono-L-tyrosine(2-) SUBMITTER O-phosphotyrosine(2-) SUBMITTER phosphonotyrosine(2-) SUBMITTER phosphotyrosine(2-) SUBMITTER tyrosine phosphate(2-) SUBMITTER A molecular messenger in which the molecule is specifically involved in transmitting information between cells. Such molecules are released from the cell sending the signal, cross over the gap between cells by diffusion, and interact with specific receptors in another cell, triggering a response in that cell by activating a series of enzyme controlled reactions which lead to changes inside the cell. chebi_ontology signal molecule signal molecules signaling molecule signaling molecules signalling molecules CHEBI:62488 signalling molecule signal molecule ChEBI signal molecule chebi signal molecules ChEBI signal molecules chebi signaling molecule ChEBI signaling molecule chebi signaling molecules ChEBI signaling molecules chebi signalling molecules ChEBI signalling molecules chebi The dicarboxylic acid dianion formed from folic acid by loss of a proton from each of the two carboxy groups in the glutamic acid moiety. chebi_ontology folate pteroyl-L-glutamate pteroyl-L-monoglutamate pteroylglutamate CHEBI:62501 folate(2-) folate metacyc.compound uniprot_ft pteroyl-L-glutamate chebi pteroyl-L-monoglutamate chebi pteroylglutamate chebi Any organophosphate oxoanion that is a negatively charged phospholipid, e.g. phosphatidylserine(1-), phosphatidate(2-), phosphatidylglycerol(1-). Any organophosphate oxoanion that is a negatively charged phospholipid, e.g. phosphatidylserine(1−), phosphatidate(2−), phosphatidylglycerol(1−). chebi_ontology anionic phospholipids phospholipid anion phospholipid anions CHEBI:62643 anionic phospholipid anionic phospholipids ChEBI anionic phospholipids chebi phospholipid anion ChEBI phospholipid anion chebi phospholipid anions ChEBI phospholipid anions chebi An amino acid derivative resulting from reaction of tyrosine at the amino group or the carboxy group, any substitution of phenyl hydrogens, or from the replacement of any hydrogen of tyrosine by a heteroatom. The definition normally excludes peptides containing tyrosine residues. chebi_ontology tyrosine derivatives CHEBI:62761 tyrosine derivative tyrosine derivatives ChEBI tyrosine derivatives chebi A family of nitrogen molecular entities which are highly reactive and derived from nitric oxide (•NO) and superoxide (O<small>₂</small>•<small>^−</small>) produced via the enzymatic activity of inducible nitric oxide synthase 2 (NOS2) and NADPH oxidase respectively. chebi_ontology RNI RNS CHEBI:62764 reactive nitrogen species RNI submitter RNS submitter Any additive that enhances the efficiency of fuel. chebi_ontology fuel additives fuel enhancer CHEBI:62803 fuel additive fuel additives ChEBI fuel additives chebi fuel enhancer ChEBI fuel enhancer chebi Any compound that is able to prevent damage to the liver. chebi_ontology antihepatotoxic agent hepatoprotective agents hepatoprotector CHEBI:62868 hepatoprotective agent antihepatotoxic agent chebi hepatoprotective agents chebi hepatoprotector chebi A polyunsaturated fatty acid anion that is the conjugate base of icosatetraenoic acid, obtained by deprotonation of the carboxy group. Major species at pH 7.3. CHEBI:78071 chebi_ontology eicosatetraenoate eicosatetranoates eicosatetranoic acid anion eicosatetranoic acid anions icosatetranoate icosatetranoates icosatetranoic acid anion icosatetranoic acid anions CHEBI:62920 icosatetraenoate eicosatetraenoate chebi eicosatetranoates chebi eicosatetranoic acid anion chebi eicosatetranoic acid anions chebi icosatetranoate chebi icosatetranoates chebi icosatetranoic acid anion chebi icosatetranoic acid anions chebi The carboxylic acid anion that is the conjugate base of an icosanoid, formed when the carboxy group is deprotonated. chebi_ontology eicosanoid anion eicosanoid anions icosanoid anion icosanoid anions CHEBI:62937 icosanoid anion eicosanoid anion chebi eicosanoid anions chebi icosanoid anion chebi icosanoid anions chebi A ceramide compound formed by the replacement of the glycosidic hydroxy group of a cyclic form of a monosaccharide (or derivative) by a ceramide group. glycosylceramides CHEBI:62941 glycosylceramide glycosylceramides ChEBI A eicosanoid anion that is the conjugate base of a leukotriene. chebi_ontology leukotriene anions CHEBI:62942 leukotriene anion leukotriene anions chebi An icosanoid anion that is the conjugate base of a prostanoid. chebi_ontology prostanoid anions CHEBI:62943 prostanoid anion prostanoid anions chebi A prostanoid anion that is the conjugate base of a thromboxane. chebi_ontology thromboxane anions CHEBI:62945 thromboxane anion thromboxane anions chebi The chemical role played by a substance that stabilizes an emulsion by increasing its kinetic stability. chebi_ontology emulgent emulgents emulsifiers CHEBI:63046 emulsifier emulgent chebi emulgents chebi emulsifiers chebi An organic cation resulting from protonation or quaternisation at the 3-position of any 1,3-thiazole. chebi_ontology 1,3-thiazolium cations CHEBI:63048 1,3-thiazolium cation 1,3-thiazolium cations chebi A β-amino-acid anion that is the conjugate base of β-alanine. chebi_ontology beta-alaninate anion beta-alaninate(1-) CHEBI:63070 beta-alaninate beta-alaninate anion chebi beta-alaninate(1-) chebi A carbohydrate derivative arising formally from the elimination of water from a glycosidic hydroxy group and an H atom bound to an oxygen, carbon, nitrogen or sulfur atom of a separate entity. chebi_ontology glycosyl compounds CHEBI:63161 glycosyl compound glycosyl compounds ChEBI glycosyl compounds chebi A substance that removes electrons from another reactant in a redox reaction. chebi_ontology oxidant oxidants oxidiser oxidisers oxidising agents oxidizer oxidizers oxidizing agent oxidizing agents CHEBI:63248 oxidising agent oxidant ChEBI oxidant chebi oxidants ChEBI oxidants chebi oxidiser ChEBI oxidiser chebi oxidisers ChEBI oxidisers chebi oxidising agents ChEBI oxidising agents chebi oxidizer ChEBI oxidizer chebi oxidizers ChEBI oxidizers chebi oxidizing agent ChEBI oxidizing agent chebi oxidizing agents ChEBI oxidizing agents chebi Any organooxygen compound derived from a carbohydrate by replacement of one or more hydroxy group(s) by an amino group, a thiol group or similar heteroatomic groups. The term also includes derivatives of these compounds. chebi_ontology carbohydrate derivatives derivatised carbohydrate derivatised carbohydrates derivatized carbohydrate derivatized carbohydrates CHEBI:63299 carbohydrate derivative carbohydrate derivatives ChEBI carbohydrate derivatives chebi derivatised carbohydrate ChEBI derivatised carbohydrate chebi derivatised carbohydrates ChEBI derivatised carbohydrates chebi derivatized carbohydrate ChEBI derivatized carbohydrate chebi derivatized carbohydrates ChEBI derivatized carbohydrates chebi An EC 3.1.3.* (phosphoric monoester hydrolase) inhibitor that interferes with the action of alkaline phosphatase (EC 3.1.3.1). Wikipedia:Alkaline_phosphatase EC 3.1.3.1 (alkaline phosphatase) inhibitors EC 3.1.3.1 inhibitor EC 3.1.3.1 inhibitors alkaline phenyl phosphatase inhibitor alkaline phenyl phosphatase inhibitors alkaline phosphatase (EC 3.1.3.1) inhibitor alkaline phosphatase (EC 3.1.3.1) inhibitors alkaline phosphatase inhibitor alkaline phosphatase inhibitors alkaline phosphohydrolase inhibitor alkaline phosphohydrolase inhibitors alkaline phosphomonoesterase inhibitor alkaline phosphomonoesterase inhibitors glycerophosphatase inhibitor glycerophosphatase inhibitors orthophosphoric-monoester phosphohydrolase (alkaline optimum) inhibitor orthophosphoric-monoester phosphohydrolase (alkaline optimum) inhibitors phosphate-monoester phosphohydrolase (alkaline optimum) inhibitor phosphate-monoester phosphohydrolase (alkaline optimum) inhibitors phosphomonoesterase inhibitor phosphomonoesterase inhibitors CHEBI:63332 EC 3.1.3.1 (alkaline phosphatase) inhibitor EC 3.1.3.1 (alkaline phosphatase) inhibitors ChEBI EC 3.1.3.1 inhibitor ChEBI EC 3.1.3.1 inhibitors ChEBI alkaline phenyl phosphatase inhibitor ChEBI alkaline phenyl phosphatase inhibitors ChEBI alkaline phosphatase (EC 3.1.3.1) inhibitor ChEBI alkaline phosphatase (EC 3.1.3.1) inhibitors ChEBI alkaline phosphatase inhibitor ChEBI alkaline phosphatase inhibitors ChEBI alkaline phosphohydrolase inhibitor ChEBI alkaline phosphohydrolase inhibitors ChEBI alkaline phosphomonoesterase inhibitor ChEBI alkaline phosphomonoesterase inhibitors ChEBI glycerophosphatase inhibitor ChEBI glycerophosphatase inhibitors ChEBI orthophosphoric-monoester phosphohydrolase (alkaline optimum) inhibitor ChEBI orthophosphoric-monoester phosphohydrolase (alkaline optimum) inhibitors ChEBI phosphate-monoester phosphohydrolase (alkaline optimum) inhibitor ChEBI phosphate-monoester phosphohydrolase (alkaline optimum) inhibitors ChEBI phosphomonoesterase inhibitor ChEBI phosphomonoesterase inhibitors ChEBI A carbohydrate derivative that is formally obtained from a monosaccharide. chebi_ontology monosaccharide derivatives CHEBI:63367 monosaccharide derivative monosaccharide derivatives ChEBI monosaccharide derivatives chebi A monosaccharide derivative that is formally obtained from a pentose. chebi_ontology pentose derivatives CHEBI:63409 pentose derivative pentose derivatives ChEBI pentose derivatives chebi A carbohydrate derivative that is formally obtained from a carbohydrate acid. chebi_ontology carbohydrate acid derivatives CHEBI:63436 carbohydrate acid derivative carbohydrate acid derivatives ChEBI carbohydrate acid derivatives chebi A sulfur-containing amino acid whose α-carboxylic acid group is ionized (not protonated). chebi_ontology sulfur-containing amino-acid anions CHEBI:63470 sulfur-containing amino-acid anion sulfur-containing amino-acid anions chebi A branched-chain amino acid whose α-carboxylic acid group is ionized. chebi_ontology branched-chain amino-acid anions CHEBI:63471 branched-chain amino-acid anion branched-chain amino-acid anions chebi An aromatic amino acid whose alpha-carboxylic acid group is ionized (non-protonated). An aromatic amino acid whose α-carboxylic acid group is ionized (non-protonated). chebi_ontology aromatic amino-acid anions CHEBI:63473 aromatic amino-acid anion aromatic amino-acid anions ChEBI aromatic amino-acid anions chebi An iodothyronine whose alpha carboxylic acid group of the tyrosine is ionized (not protonated). chebi_ontology iodothyroninates CHEBI:63477 iodothyroninate iodothyroninates chebi A substance capable of undergoing rapid and highly exothermic decomposition. chebi_ontology explosive compound explosive compounds explosive material explosives explosives chemical explosives chemicals CHEBI:63490 explosive explosive compound chebi explosive compounds chebi explosive material chebi explosives chebi explosives chemical chebi explosives chemicals chebi An aralylamino compound which contains one amino group connected to an aromatic ring by a two-carbon chain. Monoamines are derived from aromatic amino acids like phenylalanine, tyrosine, tryptophan, and the thyroid hormones by the action of aromatic amino acid decarboxylase enzymes. chebi_ontology monoamines naturally occurring monoamine naturally occurring monoamines CHEBI:63534 monoamine monoamines ChEBI monoamines chebi naturally occurring monoamine ChEBI naturally occurring monoamine chebi naturally occurring monoamines ChEBI naturally occurring monoamines chebi A carboxylic acid anion resulting from the deprotonation of the carboxy group of a carbohydrate acid derivative. chebi_ontology carbohydrate acid anion derivative carbohydrate acid anion derivatives carbohydrate acid derivative anions CHEBI:63551 carbohydrate acid derivative anion carbohydrate acid anion derivative ChEBI carbohydrate acid anion derivative chebi carbohydrate acid anion derivatives ChEBI carbohydrate acid anion derivatives chebi carbohydrate acid derivative anions ChEBI carbohydrate acid derivative anions chebi Any compound that can be used for the treatment of neurodegenerative disorders. chebi_ontology neuroprotectant neuroprotectants neuroprotective agents CHEBI:63726 neuroprotective agent neuroprotectant chebi neuroprotectants chebi neuroprotective agents chebi Any fatty acid carrying one or more hydroperoxy substituents. chebi_ontology hydroperoxy fatty acids CHEBI:64009 hydroperoxy fatty acid hydroperoxy fatty acids chebi A fatty acid anion that is the conjugate base of any hydroperoxy fatty acid, formed by deprotonation of the carboxylic acid moiety. chebi_ontology hydroperoxy fatty acid anions CHEBI:64012 hydroperoxy fatty acid anion hydroperoxy fatty acid anions chebi Any substance which is added to food to preserve or enhance its flavour and/or appearance. Wikipedia:Food_additive chebi_ontology food additives CHEBI:64047 food additive food additives ChEBI food additives chebi A food additive that is used to change or otherwise control the acidity or alkalinity of foods. They may be acids, bases, neutralising agents or buffering agents. Wikipedia:Acidity_regulator chebi_ontology acidity regulator acidity regulators food acidity regulators pH control agent pH control agents CHEBI:64049 food acidity regulator acidity regulator ChEBI acidity regulator chebi acidity regulators ChEBI acidity regulators chebi food acidity regulators ChEBI food acidity regulators chebi pH control agent ChEBI pH control agent chebi pH control agents ChEBI pH control agents chebi An organic amino compound in which an aminoalkyl group is linked to an arene. chebi_ontology aralkylamino compounds CHEBI:64365 aralkylamino compound aralkylamino compounds ChEBI aralkylamino compounds chebi An EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor, NAD(+) or NADP(+) as acceptor) inhibitor that interferes with the action of arogenate dehydrogenase (EC 1.3.1.43). Wikipedia:Arogenate_dehydrogenase EC 1.3.1.43 (arogenate dehydrogenase) inhibitors EC 1.3.1.43 inhibitor EC 1.3.1.43 inhibitors L-arogenate:NAD(+) oxidoreductase (decarboxylating) inhibitor L-arogenate:NAD(+) oxidoreductase (decarboxylating) inhibitors L-arogenate:NAD+ oxidoreductase (decarboxylating) inhibitor L-arogenate:NAD+ oxidoreductase (decarboxylating) inhibitors L-arogenate:NAD+ oxidoreductase inhibitor L-arogenate:NAD+ oxidoreductase inhibitors TyrA(a) inhibitor TyrA(a) inhibitors arogenate dehydrogenase (EC 1.3.1.43) inhibitor arogenate dehydrogenase (EC 1.3.1.43) inhibitors arogenate dehydrogenase inhibitor arogenate dehydrogenase inhibitors cyclohexadienyl dehydrogenase inhibitor cyclohexadienyl dehydrogenase inhibitors CHEBI:64416 EC 1.3.1.43 (arogenate dehydrogenase) inhibitor EC 1.3.1.43 (arogenate dehydrogenase) inhibitors ChEBI EC 1.3.1.43 inhibitor ChEBI EC 1.3.1.43 inhibitors ChEBI L-arogenate:NAD(+) oxidoreductase (decarboxylating) inhibitor ChEBI L-arogenate:NAD(+) oxidoreductase (decarboxylating) inhibitors ChEBI L-arogenate:NAD+ oxidoreductase (decarboxylating) inhibitor ChEBI L-arogenate:NAD+ oxidoreductase (decarboxylating) inhibitors ChEBI L-arogenate:NAD+ oxidoreductase inhibitor ChEBI L-arogenate:NAD+ oxidoreductase inhibitors ChEBI TyrA(a) inhibitor ChEBI TyrA(a) inhibitors ChEBI arogenate dehydrogenase (EC 1.3.1.43) inhibitor ChEBI arogenate dehydrogenase (EC 1.3.1.43) inhibitors ChEBI arogenate dehydrogenase inhibitor ChEBI arogenate dehydrogenase inhibitors ChEBI cyclohexadienyl dehydrogenase inhibitor ChEBI cyclohexadienyl dehydrogenase inhibitors ChEBI An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of tryptophan; major species at pH 7.3. chebi_ontology 2-ammonio-3-(1H-indol-3-yl)propanoate CHEBI:64554 tryptophan zwitterion 2-ammonio-3-(1H-indol-3-yl)propanoate iupac An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of methionine; major species at pH 7.3. chebi_ontology 2-ammonio-4-(methylsulfanyl)butanoate methionine CHEBI:64558 methionine zwitterion 2-ammonio-4-(methylsulfanyl)butanoate iupac methionine uniprot_ft An EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor that interferes with the action of glycine hydroxymethyltransferase (EC 2.1.2.1). chebi_ontology 5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitor 5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitors EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitors EC 2.1.2.1 inhibitor EC 2.1.2.1 inhibitors L-serine hydroxymethyltransferase inhibitor L-serine hydroxymethyltransferase inhibitors L-threonine aldolase inhibitor L-threonine aldolase inhibitors allothreonine aldolase inhibitor allothreonine aldolase inhibitors glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitor glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitors glycine hydroxymethyltransferase inhibitor glycine hydroxymethyltransferase inhibitors serine aldolase inhibitor serine aldolase inhibitors serine hydroxymethylase inhibitor serine hydroxymethylase inhibitors serine hydroxymethyltransferase inhibitor serine hydroxymethyltransferase inhibitors serine transhydroxymethylase inhibitor serine transhydroxymethylase inhibitors threonine aldolase inhibitor threonine aldolase inhibitors CHEBI:64570 EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitor 5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitor chebi 5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitors chebi EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitors chebi EC 2.1.2.1 inhibitor chebi EC 2.1.2.1 inhibitors chebi L-serine hydroxymethyltransferase inhibitor chebi L-serine hydroxymethyltransferase inhibitors chebi L-threonine aldolase inhibitor chebi L-threonine aldolase inhibitors chebi allothreonine aldolase inhibitor chebi allothreonine aldolase inhibitors chebi glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitor chebi glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitors chebi glycine hydroxymethyltransferase inhibitor chebi glycine hydroxymethyltransferase inhibitors chebi serine aldolase inhibitor chebi serine aldolase inhibitors chebi serine hydroxymethylase inhibitor chebi serine hydroxymethylase inhibitors chebi serine hydroxymethyltransferase inhibitor chebi serine hydroxymethyltransferase inhibitors chebi serine transhydroxymethylase inhibitor chebi serine transhydroxymethylase inhibitors chebi threonine aldolase inhibitor chebi threonine aldolase inhibitors chebi An excitatory amino acid agonist which binds to NMDA receptors and triggers a response. chebi_ontology N-methyl-D-aspartate receptor agonist N-methyl-D-aspartate receptor agonists NMDA receptor agonists NMDAR agonist NMDAR agonists CHEBI:64571 NMDA receptor agonist N-methyl-D-aspartate receptor agonist chebi N-methyl-D-aspartate receptor agonists chebi NMDA receptor agonists chebi NMDAR agonist chebi NMDAR agonists chebi A food additive which is added to flour or dough to improve baking quality and/or colour. chebi_ontology dough improver dough improvers flour treatment agent improving agent improving agents CHEBI:64577 flour treatment agent dough improver chebi dough improvers chebi flour treatment agent chebi improving agent chebi improving agents chebi Any of a class of phospholipids in which the amino group of a sphingoid base is in amide linkage with one of several fatty acids, while the terminal hydroxy group of the sphingoid base is esterified to phosphorylcholine. chebi_ontology Ceramide phosphocholine an N-(acyl)-sphingosylphosphocholine CHEBI:64583 sphingomyelin Ceramide phosphocholine LIPID_MAPS Ceramide phosphocholine lipidmaps an N-(acyl)-sphingosylphosphocholine UniProt an N-(acyl)-sphingosylphosphocholine uniprot_ft An agonist that binds to and activates glycine receptors chebi_ontology glycine receptor agonists CHEBI:64589 glycine receptor agonist glycine receptor agonists chebi A steroid compound with a structure based on a 21-carbon (pregnane) skeleton that acts as a hormone. chebi_ontology C21-steroid hormones CHEBI:64600 C21-steroid hormone C21-steroid hormones ChEBI C21-steroid hormones chebi A lipid similar in structure to a glycerolipid but in which one or more of the carbon atoms on glycerol is bonded to an alkyl chain via an ether linkage, as opposed to the usual ester linkage. chebi_ontology ether glycerolipid ether glycerolipids ether lipids CHEBI:64611 ether lipid ether glycerolipid chebi ether glycerolipids chebi ether lipids chebi A fourteen-membered heterodetic cyclic peptide comprising the sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys cyclised by a disulfide bridge between the two Cys residues at positions 3 and 14. HMDB:HMDB0013072 KEGG:C16022 KEGG:D07431 LINCS:LSM-5326 Wikipedia:Somatostatin Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide Somatostatin-1 Somatostatin-14 Synthetic growth hormone release-inhibiting hormone CHEBI:64628 somatostatin Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] ChEBI L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide ChemIDplus Somatostatin-1 KEGG_COMPOUND Somatostatin-14 KEGG_COMPOUND Synthetic growth hormone release-inhibiting hormone ChemIDplus An inorganic cation with a valency of two. CHEBI:64641 divalent inorganic cation An organic molecular entity containing a single carbon atom (C1). An organic molecular entity containing a single carbon atom (C<small>₁</small>). chebi_ontology one-carbon compounds CHEBI:64708 one-carbon compound one-carbon compounds ChEBI one-carbon compounds chebi Any organic molecular entity that is acidic and contains carbon in covalent linkage. chebi_ontology organic acids CHEBI:64709 organic acid organic acids ChEBI organic acids chebi A group that carries an overall positive charge. chebi_ontology cationic groups CHEBI:64766 cationic group cationic groups ChEBI cationic groups chebi A group that carries an overall negative charge. chebi_ontology anionic groups CHEBI:64767 anionic group anionic groups ChEBI anionic groups chebi A cationic group that contains carbon. chebi_ontology organic cationic groups CHEBI:64769 organic cationic group organic cationic groups ChEBI organic cationic groups chebi An anionic group that contains carbon. chebi_ontology organic anionic groups CHEBI:64775 organic anionic group organic anionic groups ChEBI organic anionic groups chebi The role played by a substance in enhancing the appearance or odour of the human body; a name given to the substance itself or to a component of it. chebi_ontology cosmetic component cosmetics CHEBI:64857 cosmetic cosmetic component chebi cosmetics chebi An amino-acid residue carrying an overall negative charge. chebi_ontology amino acid anion residue amino acid anion residues amino-acid anion residue amino-acid anion residues anionic amino acid residue anionic amino acid residues CHEBI:64898 anionic amino-acid residue amino acid anion residue ChEBI amino acid anion residue chebi amino acid anion residues ChEBI amino acid anion residues chebi amino-acid anion residue ChEBI amino-acid anion residue chebi amino-acid anion residues ChEBI amino-acid anion residues chebi anionic amino acid residue ChEBI anionic amino acid residue chebi anionic amino acid residues ChEBI anionic amino acid residues chebi Any substance that causes disturbance to organisms by chemical reaction or other activity on the molecular scale, when a sufficient quantity is absorbed by the organism. Wikipedia:Poison chebi_ontology poisonous agent poisonous agents poisonous substance poisonous substances poisons toxic agent toxic agents toxic substance toxic substances CHEBI:64909 poison poisonous agent ChEBI poisonous agent chebi poisonous agents ChEBI poisonous agents chebi poisonous substance ChEBI poisonous substance chebi poisonous substances ChEBI poisonous substances chebi poisons ChEBI poisons chebi toxic agent ChEBI toxic agent chebi toxic agents ChEBI toxic agents chebi toxic substance ChEBI toxic substance chebi toxic substances ChEBI toxic substances chebi A clathrate complex consisting of a lipid enwrapped in a protein host without covalent binding in such a way that the complex has a hydrophilic outer surface consisting of all the protein and the polar ends of any phospholipids. KEGG:C01834 Lipoprotein chebi_ontology Lipoprotein lipoprotein particle CHEBI:6495 lipoprotein Lipoprotein KEGG_COMPOUND Lipoprotein kegg.compound lipoprotein particle ChEBI lipoprotein particle chebi A carbohydrate derivative that is any derivative of a polysaccharide. chebi_ontology polysaccharide derivatives CHEBI:65212 polysaccharide derivative polysaccharide derivatives ChEBI polysaccharide derivatives chebi Substances which are added to food in order to prevent decomposition caused by microbial growth or by undesirable chemical changes. chebi_ontology food preservatives CHEBI:65255 food preservative food preservatives ChEBI food preservatives chebi A food preservative which prevents decomposition of food by preventing the growth of fungi or bacteria. In European countries, E-numbers for permitted food preservatives are from E200 to E299, divided into sorbates (E200-209), benzoates (E210-219), sulfites (E220-229), phenols and formates (E230-239), nitrates (E240-259), acetates (E260-269), lactates (E270-279), propionates (E280-289) and others (E290-299). chebi_ontology antimicrobial food preservatives antimicrobial preservative antimicrobial preservatives CHEBI:65256 antimicrobial food preservative antimicrobial food preservatives ChEBI antimicrobial food preservatives chebi antimicrobial preservative ChEBI antimicrobial preservative chebi antimicrobial preservatives ChEBI antimicrobial preservatives chebi A compound that inhibits the action of γ-aminobutyric acid. chebi_ontology GABA antagonists gamma-aminobutyric acid receptor antagonist gamma-aminobutyric acid receptor antagonists CHEBI:65259 GABA antagonist GABA antagonists chebi gamma-aminobutyric acid receptor antagonist chebi gamma-aminobutyric acid receptor antagonists chebi Any substance which is used to neutralise stomach acidity. Wikipedia:Antacid antacids CHEBI:65265 antacid antacids ChEBI An ammonium ion derivative resulting from the protonation of the nitrogen atom of a primary amino compound. Major species at pH 7.3. chebi_ontology a primary amine substituted ammonium CHEBI:65296 primary ammonium ion a primary amine UniProt a primary amine uniprot_ft substituted ammonium ChEBI substituted ammonium chebi Any dicarboxylic acid that contains four carbon atoms. chebi_ontology C4-dicarboxylic acids CHEBI:66873 C4-dicarboxylic acid C4-dicarboxylic acids chebi An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of alanine; major species at pH 7.3. chebi_ontology 2-ammoniopropanoate CHEBI:66916 alanine zwitterion 2-ammoniopropanoate iupac An α-amino acid anion that is the conjugate base of citrulline, obtained by deprotonation of the carboxy group. chebi_ontology CHEBI:66922 citrullinate A monocarboxylic acid anion that is the conjugate base of creatine, obtained by deprotonation of the carboxy group. chebi_ontology (N-methylcarbamimidamido)acetate N-[amino(imino)methyl]-N-methylglycinate CHEBI:66924 creatinate (N-methylcarbamimidamido)acetate chebi N-[amino(imino)methyl]-N-methylglycinate chebi An α-amino acid anion that is the conjugate base of homocysteine, obtained by deprotonation of the carboxy group. chebi_ontology CHEBI:66952 homocysteinate An <em>N</em>-acyl-<small>L</small>-α-amino acid anion obtained by deprotonation of any folic acid. chebi_ontology folate folate anion folate anions CHEBI:67011 folates folate chebi folate anion chebi folate anions chebi An agonist that binds to and activates cannabinoid receptors. chebi_ontology cannabinoid receptor agonists CHEBI:67072 cannabinoid receptor agonist cannabinoid receptor agonists chebi Any compound that has anti-inflammatory effects. anti-inflammatory agents antiinflammatory agent antiinflammatory agents CHEBI:67079 anti-inflammatory agent anti-inflammatory agents ChEBI antiinflammatory agent ChEBI antiinflammatory agents ChEBI A diverse group of pharmacologically active secondary metabolite characteristic to <em>Cannabis</em> plant as well as produced naturally in the body by humans and animals. Cannabinoids contain oxygen as a part of the heterocyclic ring or in the form of various functional groups. They are subdivided on the basis of their origin. chebi_ontology cannabinoids CHEBI:67194 cannabinoid cannabinoids chebi A class of cannabinoids present in mammalian biological fluids and tissues that activate cannabinoid receptors. chebi_ontology endocannabinoids CHEBI:67197 endocannabinoid endocannabinoids chebi Any monocyclic heteroarene consisting of a five-membered ring containing nitrogen. Azoles can also contain one or more other non-carbon atoms, such as nitrogen, sulfur or oxygen. Wikipedia:Azole chebi_ontology azoles CHEBI:68452 azole azoles ChEBI azoles chebi Any substance that induces the process of apoptosis (programmed cell death) in multi-celled organisms. chebi_ontology Type I cell-death inducer Type I cell-death inducers Type I programmed cell-death inducer Type I programmed cell-death inducers apoptosis inducers CHEBI:68495 apoptosis inducer Type I cell-death inducer chebi Type I cell-death inducers chebi Type I programmed cell-death inducer chebi Type I programmed cell-death inducers chebi apoptosis inducers chebi chebi_ontology Myoglobin CHEBI:7044 myoglobin Myoglobin kegg.compound A hormone agonist that binds to and activates progesterone receptors. chebi_ontology PR agonist PR agonists progesterone receptor agonists CHEBI:70709 progesterone receptor agonist PR agonist ChEBI PR agonist chebi PR agonists ChEBI PR agonists chebi progesterone receptor agonists ChEBI progesterone receptor agonists chebi An enzyme inhibitor that inhibits the action of a transferase (EC 2.*) chebi_ontology EC 2 inhibitor EC 2 inhibitors EC 2.* (transferase) inhibitors EC 2.* inhibitor EC 2.* inhibitors transferase inhibitor transferase inhibitors CHEBI:71300 EC 2.* (transferase) inhibitor EC 2 inhibitor chebi EC 2 inhibitors chebi EC 2.* (transferase) inhibitors chebi EC 2.* inhibitor chebi EC 2.* inhibitors chebi transferase inhibitor chebi transferase inhibitors chebi An organic cation that is the conjugate acid of (<i>R</i>)-adrenaline, obtained by protonation of the amino group; major species at pH 7.3. An organic cation that is the conjugate acid of (R)-adrenaline, obtained by protonation of the amino group; major species at pH 7.3. MetaCyc:L-EPINEPHRINE chebi_ontology (R)-adrenaline (R)-adrenaline cation L-epinephrine cation L-epinephrine(1+) CHEBI:71406 (R)-adrenaline(1+) (R)-adrenaline UniProt (R)-adrenaline uniprot_ft (R)-adrenaline cation ChEBI (R)-adrenaline cation chebi L-epinephrine cation ChEBI L-epinephrine cation chebi L-epinephrine(1+) ChEBI L-epinephrine(1+) chebi An amino-acid anion in which the amino group is situated gamma- to the carboxylate group. An amino-acid anion in which the amino group is situated γ- to the carboxylate group. chebi_ontology gamma-amino acid anions CHEBI:71666 gamma-amino acid anion gamma-amino acid anions ChEBI gamma-amino acid anions chebi An organic cation that is the conjugate acid of (R)-noradrenaline, obtained by protonation of the priamry amino group; major species at pH 7.3. PDBeChem:E5E (R)-noradrenaline (R)-noradrenaline cation (R)-noradrenalinium cation (R)-noradrenalinium(1+) CHEBI:72587 (R)-noradrenaline(1+) (R)-noradrenaline UniProt (R)-noradrenaline cation ChEBI (R)-noradrenalinium cation ChEBI (R)-noradrenalinium(1+) ChEBI Any organic molecular entity derived from a natural product by partial chemical synthesis. chebi_ontology semi-synthetic compound semi-synthetic compounds semi-synthetic derivative semi-synthetic derivatives semisynthetic compound semisynthetic compounds semisynthetic derivatives CHEBI:72588 semisynthetic derivative semi-synthetic compound chebi semi-synthetic compounds chebi semi-synthetic derivative chebi semi-synthetic derivatives chebi semisynthetic compound chebi semisynthetic compounds chebi semisynthetic derivatives chebi Any molecule that consists of at least one carbon atom as part of the electrically neutral entity. chebi_ontology organic compound organic compounds organic molecules CHEBI:72695 organic molecule organic compound ChEBI organic compound chebi organic compounds ChEBI organic compounds chebi organic molecules ChEBI organic molecules chebi A biomacromolecule composed of carbohydrate residues which is secreted by a microorganism into the surrounding environment. MetaCyc:Exopolysaccharides Wikipedia:Exopolysaccharide Wikipedia:Extracellular_polymeric_substance chebi_ontology exopolysaccharides extracellular polymeric substance extracellular polymeric substances CHEBI:72813 exopolysaccharide exopolysaccharides ChEBI exopolysaccharides chebi extracellular polymeric substance ChEBI extracellular polymeric substance chebi extracellular polymeric substances ChEBI extracellular polymeric substances chebi A mancude heterobicyclic organic group consisting of a benzene ring fused to a pyrrole ring. chebi_ontology CHEBI:73398 indole skeleton A bicyclic organic group that contains both carbon and hetero atoms. chebi_ontology organic heterobicyclic rings CHEBI:73541 organic heterobicyclic ring organic heterobicyclic rings ChEBI organic heterobicyclic rings chebi An L-alpha-amino acid which is biosynthesised from erythrose 4-phosphate and phosphoenolpyruvate (i.e. phenylalanine, tyrosine, and tryptophan). A closed class. erythrose 4-phosphate and phosphoenolpyruvate family amino acid erythrose 4-phosphate and phosphoenolpyruvate family amino acids erythrose 4-phosphate family amino acid erythrose 4-phosphate family amino acids erythrose 4-phosphate/phosphoenolpyruvate family amino acids phosphoenolpyruvate family amino acid phosphoenolpyruvate family amino acids CHEBI:73690 erythrose 4-phosphate/phosphoenolpyruvate family amino acid erythrose 4-phosphate and phosphoenolpyruvate family amino acid ChEBI erythrose 4-phosphate and phosphoenolpyruvate family amino acids ChEBI erythrose 4-phosphate family amino acid ChEBI erythrose 4-phosphate family amino acids ChEBI erythrose 4-phosphate/phosphoenolpyruvate family amino acids ChEBI phosphoenolpyruvate family amino acid ChEBI phosphoenolpyruvate family amino acids ChEBI A carbonyl compound produced as a water-soluble byproduct when fatty acids are broken down for energy in the liver. There are three endogenous ketone bodies: acetone, acetoacetic acid, and (<i>R</i>)-3-hydroxybutyric acid; others may be produced as a result of the metabolism of synthetic triglycerides. chebi_ontology ketone bodies CHEBI:73693 ketone body ketone bodies chebi A dicarboxylic acid obtained by substitution of one of the methylene hydrogens of malonic acid by an ethyl group. chebi_ontology 1,1-propanedicarboxylic acid 2-ethylmalonic acid alpha-carboxybutyric acid CHEBI:741548 ethylmalonic acid 1,1-propanedicarboxylic acid chemidplus 2-ethylmalonic acid nist alpha-carboxybutyric acid chemidplus An optically active form of O(4)-phosphonatotyrosine(2-) having D-configuration. (2R)-2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate O(4)-phospho-D-tyrosine(2-) O-phospho-D-tyrosine(2-) CHEBI:74656 O(4)-phosphonato-D-tyrosine(2-) (2R)-2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate IUPAC O(4)-phospho-D-tyrosine(2-) ChEBI O-phospho-D-tyrosine(2-) SUBMITTER Protein characterized by a compact, spherical shape and generally soluble in water chebi_ontology CHEBI:746933 globular protein Any well-characterized compound that serves as a standard for the identification, quantification, calibration, or quality control of substances in scientific analysis. chebi_ontology reference compounds reference standard reference standards CHEBI:747204 reference compound reference compounds chebi reference standard chebi reference standards chebi a role for a chemical additive to a mixture chebi_ontology CHEBI:747325 additive A compound that causes the contraction of body tissues, typically used to reduce bleeding from minor abrasions. Wikipedia:Astringent chebi_ontology adstringent adstringents astringents CHEBI:74783 astringent adstringent ChEBI adstringent chebi adstringents ChEBI adstringents chebi astringents ChEBI astringents chebi An organophosphate oxoanion arising from deprotonation of the phospho and carboxy groups as well as protonation of the amino group of O(4)-phosphotyrosine 2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate O(4)-phosphotyrosine(2-) O-phosphotyrosine(2-) phosphotyrosine(2-) CHEBI:74955 O(4)-phosphonatotyrosine(2-) 2-ammonio-3-[4-(phosphonatooxy)phenyl]propanoate IUPAC O(4)-phosphotyrosine(2-) ChEBI O-phosphotyrosine(2-) ChEBI phosphotyrosine(2-) ChEBI A non-proteinogenic alpha-amino acid that is tyrosine phosphorylated at the phenolic hydroxy group. O-phosphotyrosine phosphotyrosine CHEBI:74956 O(4)-phosphotyrosine O-phosphotyrosine ChEBI phosphotyrosine ChEBI A D-tyrosine derivative that is D-tyrosine phosphorylated at the phenolic hydroxy group. MetaCyc:CPD-3729 O-phospho-D-tyrosine CHEBI:74959 O(4)-phospho-D-tyrosine O-phospho-D-tyrosine ChEBI A 28-membered appetite-stimulating polypeptide consisting of Gly, Ser, Ser(octanoyl), Phe, Leu, Ser, Pro, Glu, His, Gln, Arg, Val, Gln, Gln, Arg, Lys, Glu, Ser, Lys, Lys, Pro, Pro, Ala, Lys, Leu, Gln, Pro and Arg residues joined in sequence. The <em>O</em>-<em>n</em>-octanoylation of the side-chain hydroxy group of serine-3 (Ser3) is essential for ghrelin's activity. chebi_ontology GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR Gastric MLTRP Ghrelin (human) Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg H-Gly-Ser-Ser(n-octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH Human ghrelin Motilin-related peptide CHEBI:75431 ghrelin GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR chebi GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR chebi Gastric MLTRP chemidplus Ghrelin (human) chemidplus Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg chebi H-Gly-Ser-Ser(n-octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH chebi Human ghrelin chemidplus Motilin-related peptide chemidplus A ligase inhibitor that interferes with the action of a <em>C</em>‒<em>N</em> bond-forming ligase (EC 6.3.*.*). A ligase inhibitor that interferes with the action of a C-N bond-forming ligase (EC 6.3.*.*). chebi_ontology C--N bond-forming ligase inhibitor C--N bond-forming ligase inhibitors C-N bond-forming ligase (EC 6.3.*) inhibitor C-N bond-forming ligase (EC 6.3.*) inhibitors C-N bond-forming ligase inhibitor C-N bond-forming ligase inhibitors EC 6.3.* (C-N bond-forming ligase) inhibitorS EC 6.3.* inhibitor EC 6.3.* inhibitors EC 6.3.*.* inhibitor EC 6.3.*.* inhibitors CHEBI:75600 EC 6.3.* (C-N bond-forming ligase) inhibitor C--N bond-forming ligase inhibitor ChEBI C--N bond-forming ligase inhibitor chebi C--N bond-forming ligase inhibitors ChEBI C--N bond-forming ligase inhibitors chebi C-N bond-forming ligase (EC 6.3.*) inhibitor ChEBI C-N bond-forming ligase (EC 6.3.*) inhibitor chebi C-N bond-forming ligase (EC 6.3.*) inhibitors ChEBI C-N bond-forming ligase (EC 6.3.*) inhibitors chebi C-N bond-forming ligase inhibitor ChEBI C-N bond-forming ligase inhibitor chebi C-N bond-forming ligase inhibitors ChEBI C-N bond-forming ligase inhibitors chebi EC 6.3.* (C-N bond-forming ligase) inhibitorS ChEBI EC 6.3.* (C-N bond-forming ligase) inhibitorS chebi EC 6.3.* inhibitor ChEBI EC 6.3.* inhibitor chebi EC 6.3.* inhibitors ChEBI EC 6.3.* inhibitors chebi EC 6.3.*.* inhibitor ChEBI EC 6.3.*.* inhibitor chebi EC 6.3.*.* inhibitors ChEBI EC 6.3.*.* inhibitors chebi Any enzyme inhibitor that interferes with the action of a ligase (EC 6.*.*.*). Ligases are enzymes that catalyse the joining of two molecules with concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate. Wikipedia:Ligase chebi_ontology EC 6.* (ligase) inhibitors EC 6.* inhibitor EC 6.* inhibitors EC 6.*.*.* inhibitor EC 6.*.*.* inhibitors ligase inhibitor ligase inhibitors CHEBI:75603 EC 6.* (ligase) inhibitor EC 6.* (ligase) inhibitors ChEBI EC 6.* (ligase) inhibitors chebi EC 6.* inhibitor ChEBI EC 6.* inhibitor chebi EC 6.* inhibitors ChEBI EC 6.* inhibitors chebi EC 6.*.*.* inhibitor ChEBI EC 6.*.*.* inhibitor chebi EC 6.*.*.* inhibitors ChEBI EC 6.*.*.* inhibitors chebi ligase inhibitor ChEBI ligase inhibitor chebi ligase inhibitors ChEBI ligase inhibitors chebi Any metabolite produced during a metabolic reaction in eukaryotes, the taxon that include members of the fungi, plantae and animalia kingdoms. chebi_ontology eukaryotic metabolites CHEBI:75763 eukaryotic metabolite eukaryotic metabolites ChEBI eukaryotic metabolites chebi Any eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals. CHEBI:77721 CHEBI:77743 chebi_ontology animal metabolites CHEBI:75767 animal metabolite animal metabolites ChEBI animal metabolites chebi Any animal metabolite produced during a metabolic reaction in mammals. CHEBI:77464 CHEBI:77744 chebi_ontology mammalian metabolites CHEBI:75768 mammalian metabolite mammalian metabolites ChEBI mammalian metabolites chebi Any member of the group of eight water-soluble vitamins originally thought to be a single compound (vitamin B) that play important roles in cell metabolism. The group comprises of vitamin B<small>₁</small>, B<small>₂</small>, B<small>₃</small>, B<small>₅</small>, B<small>₆</small>, B<small>₇</small>, B<small>₉</small>, and B<small>₁₂</small> (Around 20 other compounds were once thought to be B vitamins but are no longer classified as such). chebi_ontology B vitamins B-group vitamin B-group vitamins vitamin B CHEBI:75769 B vitamin B vitamins chebi B-group vitamin chebi B-group vitamins chebi vitamin B chebi Any mammalian metabolite produced during a metabolic reaction in a mouse (<em>Mus musculus</em>). Any mammalian metabolite produced during a metabolic reaction in a mouse (Mus musculus). chebi_ontology Mus musculus metabolite Mus musculus metabolites mouse metabolites CHEBI:75771 mouse metabolite Mus musculus metabolite ChEBI Mus musculus metabolite chebi Mus musculus metabolites ChEBI Mus musculus metabolites chebi mouse metabolites ChEBI mouse metabolites chebi Any fungal metabolite produced during a metabolic reaction in Baker's yeast (<em>Saccharomyces cerevisiae </em>). Any fungal metabolite produced during a metabolic reaction in Baker's yeast (Saccharomyces cerevisiae). CHEBI:76949 CHEBI:76951 chebi_ontology S. cerevisiae metabolite S. cerevisiae metabolites S. cerevisiae secondary metabolite S. cerevisiae secondary metabolites Saccharomyces cerevisiae metabolites Saccharomyces cerevisiae secondary metabolites baker's yeast metabolite baker's yeast metabolites baker's yeast secondary metabolite baker's yeast secondary metabolites CHEBI:75772 Saccharomyces cerevisiae metabolite S. cerevisiae metabolite ChEBI S. cerevisiae metabolite chebi S. cerevisiae metabolites ChEBI S. cerevisiae metabolites chebi S. cerevisiae secondary metabolite ChEBI S. cerevisiae secondary metabolite chebi S. cerevisiae secondary metabolites ChEBI S. cerevisiae secondary metabolites chebi Saccharomyces cerevisiae metabolites ChEBI Saccharomyces cerevisiae metabolites chebi Saccharomyces cerevisiae secondary metabolites ChEBI Saccharomyces cerevisiae secondary metabolites chebi baker's yeast metabolite ChEBI baker's yeast metabolite chebi baker's yeast metabolites ChEBI baker's yeast metabolites chebi baker's yeast secondary metabolite ChEBI baker's yeast secondary metabolite chebi baker's yeast secondary metabolites ChEBI baker's yeast secondary metabolites chebi Any metabolite produced during a metabolic reaction in prokaryotes, the taxon that include members of domains such as the bacteria and archaea. chebi_ontology prokaryotic metabolites CHEBI:75787 prokaryotic metabolite prokaryotic metabolites ChEBI prokaryotic metabolites chebi An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of any aromatic amino-acid. chebi_ontology an aromatic amino-acid aromatic amino-acid zwitterions CHEBI:76042 aromatic amino-acid zwitterion an aromatic amino-acid UniProt an aromatic amino-acid uniprot_ft aromatic amino-acid zwitterions ChEBI aromatic amino-acid zwitterions chebi Any metabolite produced by metabolism of a xenobiotic compound. chebi_ontology xenobiotic metabolites CHEBI:76206 xenobiotic metabolite xenobiotic metabolites ChEBI xenobiotic metabolites chebi A gas in an atmosphere that absorbs and emits radiation within the thermal infrared range, so contributing to the 'greenhouse effect'. Wikipedia:Greenhouse_gas chebi_ontology greenhouse gases CHEBI:76413 greenhouse gas greenhouse gases ChEBI greenhouse gases chebi A compressed gas or liquid with a boiling point lower than room temperature which to used to propel and dispense liquids such as deodorants, insecticides, paints, etc. from aerosol cans. chebi_ontology propellants CHEBI:76414 propellant propellants ChEBI propellants chebi Any unsaturated fatty acid anion containing more than one C-C unsaturated bond. Major species at pH 7.3. chebi_ontology PUFA polyunsaturated fatty acid anions CHEBI:76567 polyunsaturated fatty acid anion PUFA submitter polyunsaturated fatty acid anions chebi Any glycerolipid that is glycerol bearing three substituent groups - either acyl, alkyl, or alk-1-enyl at each of the three possible positions. chebi_ontology triradylglycerols CHEBI:76579 triradylglycerol triradylglycerols chebi A transferase inhibitor inhibiting the action of transferase of a one-carbon-containing group (EC 2.1.*.*). chebi_ontology C1-transferase (EC 2.1.*) inhibitor C1-transferase (EC 2.1.*) inhibitors C1-transferase inhibitor C1-transferase inhibitors EC 2.1.* (C1-transferase) inhibitors EC 2.1.* inhibitor EC 2.1.* inhibitors one-carbon-containing group transferase inhibitor one-carbon-containing group transferase inhibitors CHEBI:76655 EC 2.1.* (C1-transferase) inhibitor C1-transferase (EC 2.1.*) inhibitor chebi C1-transferase (EC 2.1.*) inhibitors chebi C1-transferase inhibitor chebi C1-transferase inhibitors chebi EC 2.1.* (C1-transferase) inhibitors chebi EC 2.1.* inhibitor chebi EC 2.1.* inhibitors chebi one-carbon-containing group transferase inhibitor chebi one-carbon-containing group transferase inhibitors chebi An enzyme inhibitor which interferes with the action of a lyase (EC 4.*.*.*). Lyases are enzymes cleaving <em>C</em>‒<em>C</em>, <em>C</em>‒<em>O</em>, <em>C</em>‒<em>N</em> and other bonds by other means than by hydrolysis or oxidation. chebi_ontology EC 4.* (lyase) inhibitors EC 4.* inhibitor EC 4.* inhibitors EC 4.*.*.* inhibitor EC 4.*.*.* inhibitors lyase (EC 4.*) inhibitor lyase (EC 4.*) inhibitorS lyase inhibitor lyase inhibitors CHEBI:76710 EC 4.* (lyase) inhibitor EC 4.* (lyase) inhibitors chebi EC 4.* inhibitor chebi EC 4.* inhibitors chebi EC 4.*.*.* inhibitor chebi EC 4.*.*.* inhibitors chebi lyase (EC 4.*) inhibitor chebi lyase (EC 4.*) inhibitorS chebi lyase inhibitor chebi lyase inhibitors chebi A lyase inhibitor which inhibits the action of a <em>C</em>‒<em>N</em> lyase (EC 4.3.*.*). chebi_ontology C-N lyase (EC 4.3.*) inhibitor C-N lyase (EC 4.3.*) inhibitors C-N lyase inhibitor C-N lyase inhibitors EC 4.3.* (C-N lyase) inhibitors EC 4.3.* inhibitor EC 4.3.* inhibitors CHEBI:76713 EC 4.3.* (C-N lyase) inhibitor C-N lyase (EC 4.3.*) inhibitor chebi C-N lyase (EC 4.3.*) inhibitors chebi C-N lyase inhibitor chebi C-N lyase inhibitors chebi EC 4.3.* (C-N lyase) inhibitors chebi EC 4.3.* inhibitor chebi EC 4.3.* inhibitors chebi An enzyme inhibitor which interferes with the action of an oxidoreductase (EC 1.*.*.*). Wikipedia:Oxidoreductase EC 1.* (oxidoreductase) inhibitors EC 1.* inhibitor EC 1.* inhibitors oxidoreductase (EC 1.*) inhibitor oxidoreductase (EC 1.*) inhibitors oxidoreductase inhibitor oxidoreductase inhibitors CHEBI:76725 EC 1.* (oxidoreductase) inhibitor EC 1.* (oxidoreductase) inhibitors ChEBI EC 1.* inhibitor ChEBI EC 1.* inhibitors ChEBI oxidoreductase (EC 1.*) inhibitor ChEBI oxidoreductase (EC 1.*) inhibitors ChEBI oxidoreductase inhibitor ChEBI oxidoreductase inhibitors ChEBI An oxidoreductase inhibitor which interferes with the action of an oxidoreductase acting on the CH-CH group of donors (EC 1.3.*.*). EC 1.3.* (oxidoreductase acting on donor CH-CH group) inhibitors EC 1.3.* inhibitor EC 1.3.* inhibitors inhibitor of oxidoreductase acting on CH-CH group of donor inhibitor of oxidoreductase acting on CH-CH group of donors inhibitors of oxidoreductase acting on CH-CH group of donor inhibitors of oxidoreductase acting on CH-CH group of donors oxidoreductase acting on donor CH-CH group (EC 1.3.*) inhibitor oxidoreductase acting on donor CH-CH group (EC 1.3.*) inhibitors oxidoreductase acting on donor CH-CH group inhibitor oxidoreductase acting on donor CH-CH group inhibitors CHEBI:76729 EC 1.3.* (oxidoreductase acting on donor CH-CH group) inhibitor EC 1.3.* (oxidoreductase acting on donor CH-CH group) inhibitors ChEBI EC 1.3.* inhibitor ChEBI EC 1.3.* inhibitors ChEBI inhibitor of oxidoreductase acting on CH-CH group of donor ChEBI inhibitor of oxidoreductase acting on CH-CH group of donors ChEBI inhibitors of oxidoreductase acting on CH-CH group of donor ChEBI inhibitors of oxidoreductase acting on CH-CH group of donors ChEBI oxidoreductase acting on donor CH-CH group (EC 1.3.*) inhibitor ChEBI oxidoreductase acting on donor CH-CH group (EC 1.3.*) inhibitors ChEBI oxidoreductase acting on donor CH-CH group inhibitor ChEBI oxidoreductase acting on donor CH-CH group inhibitors ChEBI Any enzyme inhibitor that interferes with the action of a hydrolase (EC 3.*.*.*). Wikipedia:Hydrolase chebi_ontology EC 3.* (hydrolase) inhibitors EC 3.* inhibitor EC 3.* inhibitors EC 3.*.*.* inhibitor EC 3.*.*.* inhibitors hydrolase (EC 3.*) inhibitor hydrolase (EC 3.*) inhibitors hydrolase inhibitor hydrolase inhibitors CHEBI:76759 EC 3.* (hydrolase) inhibitor EC 3.* (hydrolase) inhibitors ChEBI EC 3.* (hydrolase) inhibitors chebi EC 3.* inhibitor ChEBI EC 3.* inhibitor chebi EC 3.* inhibitors ChEBI EC 3.* inhibitors chebi EC 3.*.*.* inhibitor ChEBI EC 3.*.*.* inhibitor chebi EC 3.*.*.* inhibitors ChEBI EC 3.*.*.* inhibitors chebi hydrolase (EC 3.*) inhibitor ChEBI hydrolase (EC 3.*) inhibitor chebi hydrolase (EC 3.*) inhibitors ChEBI hydrolase (EC 3.*) inhibitors chebi hydrolase inhibitor ChEBI hydrolase inhibitor chebi hydrolase inhibitors ChEBI hydrolase inhibitors chebi A hydrolase inhibitor that interferes with the action of any ester hydrolase (EC 3.1.*.*). chebi_ontology EC 3.1.* (ester hydrolase) inhibitors EC 3.1.* inhibitor EC 3.1.* inhibitors ester hydrolase (EC 3.1.*) inhibitor ester hydrolase (EC 3.1.*) inhibitors ester hydrolase inhibitor ester hydrolase inhibitors CHEBI:76760 EC 3.1.* (ester hydrolase) inhibitor EC 3.1.* (ester hydrolase) inhibitors ChEBI EC 3.1.* (ester hydrolase) inhibitors chebi EC 3.1.* inhibitor ChEBI EC 3.1.* inhibitor chebi EC 3.1.* inhibitors ChEBI EC 3.1.* inhibitors chebi ester hydrolase (EC 3.1.*) inhibitor ChEBI ester hydrolase (EC 3.1.*) inhibitor chebi ester hydrolase (EC 3.1.*) inhibitors ChEBI ester hydrolase (EC 3.1.*) inhibitors chebi ester hydrolase inhibitor ChEBI ester hydrolase inhibitor chebi ester hydrolase inhibitors ChEBI ester hydrolase inhibitors chebi Any hydrolase inhibitor that interferes with the action of a hydrolase acting on C-N bonds, other than peptide bonds (EC 3.5.*.*). chebi_ontology EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors EC 3.5.* inhibitor EC 3.5.* inhibitors CHEBI:76764 EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor ChEBI EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor chebi EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors ChEBI EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors chebi EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor ChEBI EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor chebi EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors ChEBI EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors chebi EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors ChEBI EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors chebi EC 3.5.* inhibitor ChEBI EC 3.5.* inhibitor chebi EC 3.5.* inhibitors ChEBI EC 3.5.* inhibitors chebi An EC 3.1.* (ester hydrolase) inhibitor that interferes with the action of a carboxylic ester hydrolase (EC 3.1.1.*). chebi_ontology EC 3.1.1.* (carboxylic ester hydrolase) inhibitors EC 3.1.1.* inhibitor EC 3.1.1.* inhibitors carboxylic ester hydrolase (EC 3.1.1.*) inhibitor carboxylic ester hydrolase (EC 3.1.1.*) inhibitors CHEBI:76773 EC 3.1.1.* (carboxylic ester hydrolase) inhibitor EC 3.1.1.* (carboxylic ester hydrolase) inhibitors chebi EC 3.1.1.* inhibitor chebi EC 3.1.1.* inhibitors chebi carboxylic ester hydrolase (EC 3.1.1.*) inhibitor chebi carboxylic ester hydrolase (EC 3.1.1.*) inhibitors chebi An EC 3.1.* (ester hydrolase) inhibitor that interferes with the action of any phosphoric monoester hydrolase (EC 3.1.3.*). EC 3.1.3.* (phosphoric monoester hydrolase) inhibitors EC 3.1.3.* inhibitor EC 3.1.3.* inhibitors inhibitor of phosphoric monoester hydrolase inhibitor of phosphoric monoester hydrolase (EC 3.1.3.*) inhibitors of phosphoric monoester hydrolase inhibitors of phosphoric monoester hydrolase (EC 3.1.3.*) phosphoric monoester hydrolase (EC 3.1.3.*) inhibitor phosphoric monoester hydrolase (EC 3.1.3.*) inhibitors phosphoric monoester hydrolase inhibitor phosphoric monoester hydrolase inhibitors CHEBI:76775 EC 3.1.3.* (phosphoric monoester hydrolase) inhibitor EC 3.1.3.* (phosphoric monoester hydrolase) inhibitors ChEBI EC 3.1.3.* inhibitor ChEBI EC 3.1.3.* inhibitors ChEBI inhibitor of phosphoric monoester hydrolase ChEBI inhibitor of phosphoric monoester hydrolase (EC 3.1.3.*) ChEBI inhibitors of phosphoric monoester hydrolase ChEBI inhibitors of phosphoric monoester hydrolase (EC 3.1.3.*) ChEBI phosphoric monoester hydrolase (EC 3.1.3.*) inhibitor ChEBI phosphoric monoester hydrolase (EC 3.1.3.*) inhibitors ChEBI phosphoric monoester hydrolase inhibitor ChEBI phosphoric monoester hydrolase inhibitors ChEBI An EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor that interferes with the action of any non-peptide linear amide C-N hydrolase (EC 3.5.1.*). chebi_ontology EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors EC 3.5.1.* inhibitor EC 3.5.1.* inhibitors non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors CHEBI:76807 EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors ChEBI EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors chebi EC 3.5.1.* inhibitor ChEBI EC 3.5.1.* inhibitor chebi EC 3.5.1.* inhibitors ChEBI EC 3.5.1.* inhibitors chebi non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor ChEBI non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor chebi non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors ChEBI non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors chebi An EC 6.3.* (<em>C</em>‒<em>N</em> bond-forming ligase) inhibitor that interferes with the action of any acid-ammonia (or amine) ligase (EC 6.3.1.*). An EC 6.3.* (C-N bond-forming ligase) inhibitor that interferes with the action of any acid-ammonia (or amine) ligase (EC 6.3.1.*). chebi_ontology EC 6.3.1.* (acid-ammonia/amine ligase) inhibitors EC 6.3.1.* inhibitor EC 6.3.1.* inhibitors acid-ammonia (or amine) ligase inhibitor acid-ammonia (or amine) ligase inhibitors CHEBI:76823 EC 6.3.1.* (acid-ammonia/amine ligase) inhibitor EC 6.3.1.* (acid-ammonia/amine ligase) inhibitors ChEBI EC 6.3.1.* (acid-ammonia/amine ligase) inhibitors chebi EC 6.3.1.* inhibitor ChEBI EC 6.3.1.* inhibitor chebi EC 6.3.1.* inhibitors ChEBI EC 6.3.1.* inhibitors chebi acid-ammonia (or amine) ligase inhibitor ChEBI acid-ammonia (or amine) ligase inhibitor chebi acid-ammonia (or amine) ligase inhibitors ChEBI acid-ammonia (or amine) ligase inhibitors chebi An EC 4.3.* (<em>C</em>‒<em>N</em> lyase) inhibitor that interferes with the action of any ammonia-lyase (EC 4.3.1.*). chebi_ontology EC 4.3.1.* (ammonia-lyase) inhibitors EC 4.3.1.* (ammonia-lyases) inhibitor EC 4.3.1.* (ammonia-lyases) inhibitors EC 4.3.1.* inhibitor EC 4.3.1.* inhibitors ammonia-lyase (EC 4.3.1.*) inhibitor ammonia-lyase (EC 4.3.1.*) inhibitors ammonia-lyase inhibitor ammonia-lyase inhibitors CHEBI:76832 EC 4.3.1.* (ammonia-lyase) inhibitor EC 4.3.1.* (ammonia-lyase) inhibitors chebi EC 4.3.1.* (ammonia-lyases) inhibitor chebi EC 4.3.1.* (ammonia-lyases) inhibitors chebi EC 4.3.1.* inhibitor chebi EC 4.3.1.* inhibitors chebi ammonia-lyase (EC 4.3.1.*) inhibitor chebi ammonia-lyase (EC 4.3.1.*) inhibitors chebi ammonia-lyase inhibitor chebi ammonia-lyase inhibitors chebi An EC 1.3.* (oxidoreductase acting on donor CH-CH group) inhibitor that interferes with the action of any such enzyme using NAD(+) or NADP(+) as acceptor (EC 1.3.1.*). EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor) inhibitor EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor) inhibitors EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor, NAD(+) or NADP(+) as acceptor) inhibitor EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor, NAD(+) or NADP(+) as acceptor) inhibitors EC 1.3.1.* (oxidoreductase acting on donor CH-CH group, NAD(+) or NADP(+) as acceptor) inhibitors EC 1.3.1.* inhibitor EC 1.3.1.* inhibitors oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor (EC 1.3.1.*) inhibitor oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor (EC 1.3.1.*) inhibitors CHEBI:76857 EC 1.3.1.* (oxidoreductase acting on donor CH-CH group, NAD(+) or NADP(+) as acceptor) inhibitor EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor) inhibitor ChEBI EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor) inhibitors ChEBI EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor, NAD(+) or NADP(+) as acceptor) inhibitor ChEBI EC 1.3.1.* (oxidoreductase acting on CH-CH group of donor, NAD(+) or NADP(+) as acceptor) inhibitors ChEBI EC 1.3.1.* (oxidoreductase acting on donor CH-CH group, NAD(+) or NADP(+) as acceptor) inhibitors ChEBI EC 1.3.1.* inhibitor ChEBI EC 1.3.1.* inhibitors ChEBI oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor (EC 1.3.1.*) inhibitor ChEBI oxidoreductase acting on CH-CH group of donor with NAD(+) or NADP(+) as acceptor (EC 1.3.1.*) inhibitors ChEBI An EC 2.1.* (C<small>₁</small>-transferase) inhibitor that interferes with the action of any hydroxymethyl-, formyl- and related transferase (EC 2.1.2.*). chebi_ontology EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitors EC 2.1.2.* inhibitor EC 2.1.2.* inhibitors hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitor hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitors CHEBI:76874 EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitors chebi EC 2.1.2.* inhibitor chebi EC 2.1.2.* inhibitors chebi hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitor chebi hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitors chebi Any eukaryotic metabolite produced during a metabolic reaction in plants, the kingdom that include flowering plants, conifers and other gymnosperms. CHEBI:75766 CHEBI:76925 chebi_ontology plant metabolites plant secondary metabolites CHEBI:76924 plant metabolite plant metabolites ChEBI plant metabolites chebi plant secondary metabolites ChEBI plant secondary metabolites chebi An enzyme inhibitor that interferes with one or more steps in a metabolic pathway. chebi_ontology metabolic pathway inhibitor metabolic pathway inhibitors pathway inhibitors CHEBI:76932 pathway inhibitor metabolic pathway inhibitor chebi metabolic pathway inhibitors chebi pathway inhibitors chebi Any eukaryotic metabolite produced during a metabolic reaction in fungi, the kingdom that includes microorganisms such as the yeasts and moulds. CHEBI:75765 CHEBI:76947 chebi_ontology fungal metabolites CHEBI:76946 fungal metabolite fungal metabolites ChEBI fungal metabolites chebi Any human metabolite produced by metabolism of a xenobiotic compound in humans. chebi_ontology human xenobiotic metabolites CHEBI:76967 human xenobiotic metabolite human xenobiotic metabolites ChEBI human xenobiotic metabolites chebi Any prokaryotic metabolite produced during a metabolic reaction in bacteria. CHEBI:75760 CHEBI:76970 chebi_ontology CHEBI:76969 bacterial metabolite Any bacterial metabolite produced during a metabolic reaction in <em>Escherichia coli</em>. Any bacterial metabolite produced during a metabolic reaction in Escherichia coli. chebi_ontology E.coli metabolite E.coli metabolites Escherichia coli metabolites CHEBI:76971 Escherichia coli metabolite E.coli metabolite ChEBI E.coli metabolite chebi E.coli metabolites ChEBI E.coli metabolites chebi Escherichia coli metabolites ChEBI Escherichia coli metabolites chebi Any bacterial metabolite produced by metabolism of a xenobiotic compound in bacteria. chebi_ontology bacterial xenobiotic metabolites CHEBI:76976 bacterial xenobiotic metabolite bacterial xenobiotic metabolites chebi A food additive that imparts colour to food. In European countries, E-numbers for permitted food colours are from E 100 to E 199, divided into yellows (E 100-109), oranges (E 110-119), reds (E 120-129), blues and violets (E 130-139), greens (E 140-149), browns and blacks (E 150-159), and others (E 160-199). Wikipedia:Food_coloring food coloring food colorings food colourings CHEBI:77182 food colouring food coloring ChEBI food colorings ChEBI food colourings ChEBI An EC 4.3.1.* (ammonia-lyase) inhibitor that interferes with the action of histidine ammonia-lyase (EC 4.3.1.3). chebi_ontology EC 4.3.1.3 (histidine ammonia-lyase) inhibitors EC 4.3.1.3 inhibitor EC 4.3.1.3 inhibitors L-histidine ammonia-lyase (urocanate-forming) inhibitor L-histidine ammonia-lyase (urocanate-forming) inhibitors L-histidine ammonia-lyase inhibitor L-histidine ammonia-lyase inhibitors histidase inhibitor histidase inhibitors histidinase inhibitor histidinase inhibitors histidine alpha-deaminase inhibitor histidine alpha-deaminase inhibitors histidine ammonia-lyase (EC 4.3.1.3) inhibitor histidine ammonia-lyase (EC 4.3.1.3) inhibitors histidine ammonia-lyase inhibitor histidine ammonia-lyase inhibitors CHEBI:77703 EC 4.3.1.3 (histidine ammonia-lyase) inhibitor EC 4.3.1.3 (histidine ammonia-lyase) inhibitors chebi EC 4.3.1.3 inhibitor chebi EC 4.3.1.3 inhibitors chebi L-histidine ammonia-lyase (urocanate-forming) inhibitor chebi L-histidine ammonia-lyase (urocanate-forming) inhibitors chebi L-histidine ammonia-lyase inhibitor chebi L-histidine ammonia-lyase inhibitors chebi histidase inhibitor chebi histidase inhibitors chebi histidinase inhibitor chebi histidinase inhibitors chebi histidine alpha-deaminase inhibitor chebi histidine alpha-deaminase inhibitors chebi histidine ammonia-lyase (EC 4.3.1.3) inhibitor chebi histidine ammonia-lyase (EC 4.3.1.3) inhibitors chebi histidine ammonia-lyase inhibitor chebi histidine ammonia-lyase inhibitors chebi Any mammalian metabolite produced during a metabolic reaction in humans (<em>Homo sapiens</em>). Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens). CHEBI:75770 CHEBI:77123 chebi_ontology H. sapiens metabolite H. sapiens metabolites Homo sapiens metabolite Homo sapiens metabolites CHEBI:77746 human metabolite H. sapiens metabolite ChEBI H. sapiens metabolite chebi H. sapiens metabolites ChEBI H. sapiens metabolites chebi Homo sapiens metabolite ChEBI Homo sapiens metabolite chebi Homo sapiens metabolites ChEBI Homo sapiens metabolites chebi A morphinane alkaloid with formula C<small>₁₈</small>H<small>₁₉</small>NO<small>₃</small>. It is the major metabolite of thebaine. chebi_ontology (5alpha)-6,7,8,14-tetradehydro-4,5-epoxy-6-methoxy-17-methylmorphinan-3-ol 3-O-demethylthebaine 6,7,8,14-tetradehydro-4,5alpha-epoxy-6-methoxy-17-methyl-morphinan-3-ol oripavine CHEBI:7782 oripavine (5alpha)-6,7,8,14-tetradehydro-4,5-epoxy-6-methoxy-17-methylmorphinan-3-ol chebi 3-O-demethylthebaine chebi 6,7,8,14-tetradehydro-4,5alpha-epoxy-6-methoxy-17-methyl-morphinan-3-ol chebi oripavine kegg.compound An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the action of amidase (EC 3.5.1.4). Wikipedia:Amidase chebi_ontology EC 3.5.1.4 (amidase) inhibitors EC 3.5.1.4 inhibitor EC 3.5.1.4 inhibitors N-acetylaminohydrolase inhibitor N-acetylaminohydrolase inhibitors acylamidase inhibitor acylamidase inhibitors acylamide amidohydrolase inhibitor acylamide amidohydrolase inhibitors amidase (EC 3.5.1.4) inhibitor amidase (EC 3.5.1.4) inhibitors amidase inhibitor amidase inhibitors amidohydrolase inhibitor amidohydrolase inhibitors deaminase inhibitor deaminase inhibitors fatty acylamidase inhibitor fatty acylamidase inhibitors CHEBI:77941 EC 3.5.1.4 (amidase) inhibitor EC 3.5.1.4 (amidase) inhibitors ChEBI EC 3.5.1.4 (amidase) inhibitors chebi EC 3.5.1.4 inhibitor ChEBI EC 3.5.1.4 inhibitor chebi EC 3.5.1.4 inhibitors ChEBI EC 3.5.1.4 inhibitors chebi N-acetylaminohydrolase inhibitor ChEBI N-acetylaminohydrolase inhibitor chebi N-acetylaminohydrolase inhibitors ChEBI N-acetylaminohydrolase inhibitors chebi acylamidase inhibitor ChEBI acylamidase inhibitor chebi acylamidase inhibitors ChEBI acylamidase inhibitors chebi acylamide amidohydrolase inhibitor ChEBI acylamide amidohydrolase inhibitor chebi acylamide amidohydrolase inhibitors ChEBI acylamide amidohydrolase inhibitors chebi amidase (EC 3.5.1.4) inhibitor ChEBI amidase (EC 3.5.1.4) inhibitor chebi amidase (EC 3.5.1.4) inhibitors ChEBI amidase (EC 3.5.1.4) inhibitors chebi amidase inhibitor ChEBI amidase inhibitor chebi amidase inhibitors ChEBI amidase inhibitors chebi amidohydrolase inhibitor ChEBI amidohydrolase inhibitor chebi amidohydrolase inhibitors ChEBI amidohydrolase inhibitors chebi deaminase inhibitor ChEBI deaminase inhibitor chebi deaminase inhibitors ChEBI deaminase inhibitors chebi fatty acylamidase inhibitor ChEBI fatty acylamidase inhibitor chebi fatty acylamidase inhibitors ChEBI fatty acylamidase inhibitors chebi A cationic sphingoid resulting from the protonation of the amino group of <small>L</small>-<i>erythro</i>-sphingosine; major species at pH 7.3. chebi_ontology L-erythro-sphing-4-enine L-erythro-sphing-4-enine(1+) CHEBI:77956 L-erythro-sphingosine(1+) L-erythro-sphing-4-enine uniprot_ft L-erythro-sphing-4-enine(1+) chebi A food additive that is used to make or keep fruit or vegetable tissues firm and crisp. or which interacts with gelling agents such as pectin to produce or strengthen a gel. Wikipedia:Firming_agent firming agent firming agents food firming agents CHEBI:77960 food firming agent firming agent ChEBI firming agents ChEBI food firming agents ChEBI An antioxidant that used as a food additives to help guard against food deterioration. chebi_ontology food antioxidants CHEBI:77962 food antioxidant food antioxidants chebi A food additive that is a (generally inert) gas which is used to envelop foodstuffs during packing and so protect them from unwanted chemical reactions such as food spoilage or oxidation during subsequent transport and storage. The term includes propellant gases, used to expel foods from a container. Wikipedia:Packaging_gas chebi_ontology food packaging gases CHEBI:77974 food packaging gas food packaging gases ChEBI food packaging gases chebi A food additive that intensifies, retains or stabilises the colour of a food. chebi_ontology color retention agent color retention agents colour retention agent colour retention agents food color retention agent food color retention agents food colour retention agents CHEBI:78006 food colour retention agent color retention agent chebi color retention agents chebi colour retention agent chebi colour retention agents chebi food color retention agent chebi food color retention agents chebi food colour retention agents chebi A propellant that is used to expel foods from an aerosol container. chebi_ontology food propellants CHEBI:78017 food propellant food propellants ChEBI food propellants chebi Any saturated fatty acid anion containing 3 carbons. Formed by deprotonation of the carboxylic acid moiety. Major species at pH 7.3. chebi_ontology fatty acid 3:0 CHEBI:78113 fatty acid anion 3:0 fatty acid 3:0 UniProt fatty acid 3:0 uniprot_ft Any saturated fatty acid anion containing 4 carbons. Formed by deprotonation of the carboxylic acid moiety. Major species at pH 7.3. chebi_ontology fatty acid 4:0 CHEBI:78115 fatty acid anion 4:0 fatty acid 4:0 UniProt fatty acid 4:0 uniprot_ft Any saturated fatty acid anion containing 6 carbons. Formed by deprotonation of the carboxylic acid moiety. Major species at pH 7.3. chebi_ontology fatty acid 6:0 CHEBI:78116 fatty acid anion 6:0 fatty acid 6:0 uniprot_ft A physiological role played by any substance that is distributed in foodstuffs. It includes materials derived from plants or animals, such as vitamins or minerals, as well as environmental contaminants. chebi_ontology dietary component dietary components food components CHEBI:78295 food component dietary component ChEBI dietary component chebi dietary components ChEBI dietary components chebi food components ChEBI food components chebi Any minor or unwanted substance introduced into the environment that can have undesired effects. chebi_ontology environmental contaminants CHEBI:78298 environmental contaminant environmental contaminants ChEBI environmental contaminants chebi A 2-hydroxy monocarboxylic acid that is propanoic acid in which one of the α-hydrogens is replaced by a hydroxy group. chebi_ontology 2-Hydroxypropanoic acid 2-Hydroxypropionic acid Lactic acid CHEBI:78320 2-hydroxypropanoic acid 2-Hydroxypropanoic acid kegg.compound 2-Hydroxypropionic acid kegg.compound Lactic acid kegg.compound A substance used in a thermodynamic heat pump cycle or refrigeration cycle that undergoes a phase change from a gas to a liquid and back. Refrigerants are used in air-conditioning systems and freezers or refrigerators and are assigned a "R" number (by ASHRAE - formerly the American Society of Heating, Refrigerating and Air Conditioning Engineers), which is determined systematically according to their molecular structure. Wikipedia:Refrigerant chebi_ontology refrigerants CHEBI:78433 refrigerant refrigerants ChEBI refrigerants chebi Any EC 3.1.1.* (carboxylic ester hydrolase) inhibitor that inhibits the action of carboxylesterase (EC 3.1.1.1 ). chebi_ontology Alpha-carboxylesterase inhibitor Alpha-carboxylesterase inhibitors Beta-esterase inhibitor Beta-esterase inhibitors EC 3.1.1.1 (carboxylesterase) inhibitors ali-esterase inhibitor ali-esterase inhibitors butyrate esterase inhibitor butyrate esterase inhibitors butyryl esterase inhibitor butyryl esterase inhibitors carboxyl ester hydrolase inhibitor carboxyl ester hydrolase inhibitors carboxylate esterase inhibitor carboxylate esterase inhibitors carboxylesterase inhibitor carboxylesterase inhibitors carboxylic acid esterase inhibitor carboxylic acid esterase inhibitors carboxylic esterase inhibitor carboxylic esterase inhibitors carboxylic-ester hydrolase inhibitor carboxylic-ester hydrolase inhibitors cocaine esterase inhibitor cocaine esterase inhibitors esterase A inhibitor esterase A inhibitors esterase B inhibitor esterase B inhibitors esterase D inhibitor esterase D inhibitors methylbutyrase inhibitor methylbutyrase inhibitors methylbutyrate esterase inhibitor methylbutyrate esterase inhibitors monobutyrase inhibitor monobutyrase inhibitors nonspecific carboxylesterase inhibitor nonspecific carboxylesterase inhibitors procaine esterase inhibitor procaine esterase inhibitors propionyl esterase inhibitor propionyl esterase inhibitors serine esterase inhibitor serine esterase inhibitors triacetin esterase inhibitor triacetin esterase inhibitors vitamin A esterase inhibitor vitamin A esterase inhibitors CHEBI:78444 EC 3.1.1.1 (carboxylesterase) inhibitor Alpha-carboxylesterase inhibitor chebi Alpha-carboxylesterase inhibitors chebi Beta-esterase inhibitor chebi Beta-esterase inhibitors chebi EC 3.1.1.1 (carboxylesterase) inhibitors chebi ali-esterase inhibitor chebi ali-esterase inhibitors chebi butyrate esterase inhibitor chebi butyrate esterase inhibitors chebi butyryl esterase inhibitor chebi butyryl esterase inhibitors chebi carboxyl ester hydrolase inhibitor chebi carboxyl ester hydrolase inhibitors chebi carboxylate esterase inhibitor chebi carboxylate esterase inhibitors chebi carboxylesterase inhibitor chebi carboxylesterase inhibitors chebi carboxylic acid esterase inhibitor chebi carboxylic acid esterase inhibitors chebi carboxylic esterase inhibitor chebi carboxylic esterase inhibitors chebi carboxylic-ester hydrolase inhibitor chebi carboxylic-ester hydrolase inhibitors chebi cocaine esterase inhibitor chebi cocaine esterase inhibitors chebi esterase A inhibitor chebi esterase A inhibitors chebi esterase B inhibitor chebi esterase B inhibitors chebi esterase D inhibitor chebi esterase D inhibitors chebi methylbutyrase inhibitor chebi methylbutyrase inhibitors chebi methylbutyrate esterase inhibitor chebi methylbutyrate esterase inhibitors chebi monobutyrase inhibitor chebi monobutyrase inhibitors chebi nonspecific carboxylesterase inhibitor chebi nonspecific carboxylesterase inhibitors chebi procaine esterase inhibitor chebi procaine esterase inhibitors chebi propionyl esterase inhibitor chebi propionyl esterase inhibitors chebi serine esterase inhibitor chebi serine esterase inhibitors chebi triacetin esterase inhibitor chebi triacetin esterase inhibitors chebi vitamin A esterase inhibitor chebi vitamin A esterase inhibitors chebi A semisynthetic opioid of formula C<small>₁₈</small>H<small>₂₁</small>NO<small>₄</small> that is derived from thebaine. It is a moderately potent opioid analgesic, generally used for relief of moderate to severe pain. chebi_ontology (-)-14-Hydroxydihydrocodeinone 4,5-Epoxy-14-hydroxy-3-methoxy-17-methylmorphinan-6-one 4,5alpha-Epoxy-14-hydroxy-3-methoxy-17-methylmorphinan-6-one Dihydro-14-hydroxycodeinone Dihydrohydroxycodeinone Dihydroxycodeinone Oxycodone CHEBI:7852 oxycodone (-)-14-Hydroxydihydrocodeinone chemidplus 4,5-Epoxy-14-hydroxy-3-methoxy-17-methylmorphinan-6-one chemidplus 4,5alpha-Epoxy-14-hydroxy-3-methoxy-17-methylmorphinan-6-one chemidplus Dihydro-14-hydroxycodeinone chemidplus Dihydrohydroxycodeinone chemidplus Dihydroxycodeinone chemidplus Oxycodone kegg.compound Any pyrimidine that bears one or more carboxylic acid substituents. chebi_ontology pyrimidinecarboxylic acids CHEBI:78574 pyrimidinecarboxylic acid pyrimidinecarboxylic acids chebi An amino acid-zwitterion obtained by transfer of a proton from the carboxy to the amino group of any alpha-amino acid; major species at pH 7.3. An amino acid-zwitterion obtained by transfer of a proton from the carboxy to the amino group of any α-amino acid; major species at pH 7.3. CHEBI:83409 chebi_ontology alpha-amino acid zwitterion alpha-amino acid zwitterions alpha-amino-acid zwitterions an alpha-amino acid CHEBI:78608 alpha-amino-acid zwitterion alpha-amino acid zwitterion ChEBI alpha-amino acid zwitterion chebi alpha-amino acid zwitterions ChEBI alpha-amino acid zwitterions chebi alpha-amino-acid zwitterions ChEBI alpha-amino-acid zwitterions chebi an alpha-amino acid UniProt an alpha-amino acid uniprot_ft Any organooxygen compound that is a polyhydroxy-aldehyde or -ketone, or a compound derived from one. Carbohydrates contain only carbon, hydrogen and oxygen and usually have an empirical formula C<small>_<em>m</em></small>(H<small>₂</small>O)<small>_<em>n</em></small>; carbohydrate derivatives may contain other elements by substitution or condensation. Any organooxygen compound that is a polyhydroxy-aldehyde or -ketone, or a compound derived from one. Carbohydrates contain only carbon, hydrogen and oxygen and usually have an empirical formula Cm(H2O)n; carbohydrate derivatives may contain other elements by substitution or condensation. chebi_ontology carbohydrates and derivatives carbohydrates and their derivatives CHEBI:78616 carbohydrates and carbohydrate derivatives carbohydrates and derivatives ChEBI carbohydrates and derivatives chebi carbohydrates and their derivatives ChEBI carbohydrates and their derivatives chebi A chromanol that is chromane in which the hydrogen at position 6 is replaced by a hydroxy group. chebi_ontology 3,4-dihydrobenzopyran-6-ol CHEBI:78631 chroman-6-ol 3,4-dihydrobenzopyran-6-ol chebi Any metabolite produced by all living cells. chebi_ontology essential metabolite essential metabolites fundamental metabolites CHEBI:78675 fundamental metabolite essential metabolite ChEBI essential metabolite chebi essential metabolites ChEBI essential metabolites chebi fundamental metabolites ChEBI fundamental metabolites chebi An animal metabolite produced by any member of the phylum Nematoda. chebi_ontology nematode metabolites CHEBI:78803 nematode metabolite nematode metabolites chebi A nematode metabolite produced by <em>Caenorhabditis elegans</em>. chebi_ontology C. elegans metabolite C. elegans metabolites Caenorhabditis elegans metabolites CHEBI:78804 Caenorhabditis elegans metabolite C. elegans metabolite chebi C. elegans metabolites chebi Caenorhabditis elegans metabolites chebi Any organic molecular entity that contains at least one C=C bond. chebi_ontology olefinic compounds CHEBI:78840 olefinic compound olefinic compounds ChEBI olefinic compounds chebi Any carbohydrate acid derivative anion obtained by deprotonation of at least one of the neuraminosyl carboxy groups of a ganglioside. chebi_ontology ganglioside anion CHEBI:79346 anionic ganglioside ganglioside anion chebi Any inorganic anion with a valency of three. chebi_ontology trivalent inorganic anions CHEBI:79387 trivalent inorganic anion trivalent inorganic anions ChEBI trivalent inorganic anions chebi Any inorganic anion with a valency of two. chebi_ontology divalent inorganic anions CHEBI:79388 divalent inorganic anion divalent inorganic anions ChEBI divalent inorganic anions chebi Any inorganic anion with a valency of one. chebi_ontology monovalent inorganic anions CHEBI:79389 monovalent inorganic anion monovalent inorganic anions ChEBI monovalent inorganic anions chebi CHEBI:138153 chebi_ontology CHEBI:81567 thyroid stimulating hormone chebi_ontology ICSH Interstitial cell stimulating hormone LH CHEBI:81568 Luteinizing hormone ICSH kegg.compound Interstitial cell stimulating hormone kegg.compound LH kegg.compound chebi_ontology FSH Follitropin CHEBI:81569 Follicle stimulating hormone FSH kegg.compound Follitropin kegg.compound An elemental molecular entity in which all of the atoms have atomic number 26. CHEBI:82663 elemental iron A <em>Daphnia</em> metabolite produced by the species <em>Daphnia galeata</em>. chebi_ontology Daphnia galeata metabolites CHEBI:83038 Daphnia galeata metabolite Daphnia galeata metabolites chebi An animal metabolite produced by arthropods such as crabs, lobsters, crayfish, shrimps and krill. chebi_ontology crustacean metabolites CHEBI:83039 crustacean metabolite crustacean metabolites ChEBI crustacean metabolites chebi A <em>Daphnia</em> metabolite produced by the species <em>Daphnia magna</em>. A Daphnia metabolite produced by the species Daphnia magna. chebi_ontology Daphnia magna metabolites CHEBI:83056 Daphnia magna metabolite Daphnia magna metabolites ChEBI Daphnia magna metabolites chebi A crustacean metabolite produced by the genus of small planktonic arthropods, <em>Daphnia</em> A crustacean metabolite produced by the genus of small planktonic arthropods, Daphnia Wikipedia:Daphnia chebi_ontology Daphnia metabolites CHEBI:83057 Daphnia metabolite Daphnia metabolites ChEBI Daphnia metabolites chebi An alpha-amino-acid residue derived from an L-alpha-amino acid. L-alpha-amino acid residue L-alpha-amino acid residues an L-alpha amino acid residue CHEBI:83228 L-alpha-amino acid residue L-alpha-amino acid residue ChEBI L-alpha-amino acid residues ChEBI an L-alpha amino acid residue UniProt An ester resulting from the formal condensation of the hydroxy group of an alcohol, phenol, heteroarenol, or enol with an organosulfonic acid. chebi_ontology organosulfonate ester organosulfonate esters organosulfonic esters CHEBI:83347 organosulfonic ester organosulfonate ester chebi organosulfonate esters chebi organosulfonic esters chebi HMDB:HMDB0000839 KEGG:C05113 Wikipedia:Porphyrin Porphyrin chebi_ontology 21H,23H-Porphin 21H,23H-porphine Porphyrin porphine CHEBI:8337 porphyrin Porphyrin KEGG_COMPOUND 21H,23H-Porphin NIST_Chemistry_WebBook 21H,23H-Porphin nist 21H,23H-porphine NIST_Chemistry_WebBook 21H,23H-porphine nist Porphyrin kegg.compound porphine ChemIDplus porphine chemidplus Any derivative of a proteinogenic amino acid resulting from reaction at an amino group, carboxy group, or a side-chain functional group, or from the replacement of any hydrogen by a heteroatom. chebi_ontology canonical amino acid derivative canonical amino acid derivatives canonical amino-acid derivative canonical amino-acid derivatives proteinogenic amino acid derivatives proteinogenic amino-acid derivative proteinogenic amino-acid derivatives CHEBI:83811 proteinogenic amino acid derivative canonical amino acid derivative ChEBI canonical amino acid derivative chebi canonical amino acid derivatives ChEBI canonical amino acid derivatives chebi canonical amino-acid derivative ChEBI canonical amino-acid derivative chebi canonical amino-acid derivatives ChEBI canonical amino-acid derivatives chebi proteinogenic amino acid derivatives ChEBI proteinogenic amino acid derivatives chebi proteinogenic amino-acid derivative ChEBI proteinogenic amino-acid derivative chebi proteinogenic amino-acid derivatives ChEBI proteinogenic amino-acid derivatives chebi Any derivative of a non-proteinogenic amino acid resulting from reaction at an amino group or carboxy group, or from the replacement of any hydrogen by a heteroatom. chebi_ontology non-canonical amino acid derivative non-canonical amino-acid derivatives non-proteinogenic amino-acid derivatives CHEBI:83812 non-proteinogenic amino acid derivative non-canonical amino acid derivative ChEBI non-canonical amino acid derivative chebi non-canonical amino-acid derivatives ChEBI non-canonical amino-acid derivatives chebi non-proteinogenic amino-acid derivatives ChEBI non-proteinogenic amino-acid derivatives chebi Any of the 23 alpha-amino acids that are precursors to proteins, and are incorporated into proteins during translation. The group includes the 20 amino acids encoded by the nuclear genes of eukaryotes together with selenocysteine, pyrrolysine, and N-formylmethionine. Apart from glycine, which is non-chiral, all have L configuration. Any of the 23 α-amino acids that are precursors to proteins, and are incorporated into proteins during translation. The group includes the 20 amino acids encoded by the nuclear genes of eukaryotes together with selenocysteine, pyrrolysine, and <em>N</em>-formylmethionine. Apart from glycine, which is non-chiral, all have <small>L</small> configuration. Wikipedia:Proteinogenic_amino_acid chebi_ontology canonical amino acid canonical amino acids proteinogenic amino acids CHEBI:83813 proteinogenic amino acid canonical amino acid ChEBI canonical amino acid chebi canonical amino acids ChEBI canonical amino acids chebi proteinogenic amino acids ChEBI proteinogenic amino acids chebi Any amino-acid that is not naturally encoded in the genetic code of any organism. Wikipedia:Non-proteinogenic_amino_acids chebi_ontology non-canonical amino acid non-canonical amino acids non-canonical amino-acid non-canonical amino-acids non-coded amino acid non-coded amino acids non-coded amino-acid non-coded amino-acids non-proteinogenic amino acids non-proteinogenic amino-acid non-proteinogenic amino-acids CHEBI:83820 non-proteinogenic amino acid non-canonical amino acid ChEBI non-canonical amino acid chebi non-canonical amino acids ChEBI non-canonical amino acids chebi non-canonical amino-acid ChEBI non-canonical amino-acid chebi non-canonical amino-acids ChEBI non-canonical amino-acids chebi non-coded amino acid ChEBI non-coded amino acid chebi non-coded amino acids ChEBI non-coded amino acids chebi non-coded amino-acid ChEBI non-coded amino-acid chebi non-coded amino-acids ChEBI non-coded amino-acids chebi non-proteinogenic amino acids ChEBI non-proteinogenic amino acids chebi non-proteinogenic amino-acid ChEBI non-proteinogenic amino-acid chebi non-proteinogenic amino-acids ChEBI non-proteinogenic amino-acids chebi Any derivative of an amino acid resulting from reaction at an amino group, carboxy group, side-chain functional group, or from the replacement of any hydrogen by a heteroatom. The definition normally excludes peptides containing amino acid residues. CHEBI:25359 chebi_ontology amino acid derivative amino acid derivatives amino-acid derivatives modified amino acids CHEBI:83821 amino-acid derivative amino acid derivative ChEBI amino acid derivative chebi amino acid derivatives ChEBI amino acid derivatives chebi amino-acid derivatives ChEBI amino-acid derivatives chebi modified amino acids ChEBI modified amino acids chebi Any L-alpha-amino acid which is not a member of the group of 23 proteinogenic amino acids. non-proteinogenic L-alpha-amino acids CHEBI:83822 non-proteinogenic L-alpha-amino acid non-proteinogenic L-alpha-amino acids ChEBI A proteinogenic amino acid derivative resulting from the formal reaction of <small>L</small>-cysteine at the amino group, carboxy group, or thiol group, or from the replacement of any hydrogen of <small>L</small>-cysteine by a heteroatom. chebi_ontology L-cysteine derivatives CHEBI:83824 L-cysteine derivative L-cysteine derivatives chebi Wikipedia:Pregnane chebi_ontology CHEBI:8386 pregnane An organic cation obtained by protonation of the amino function of any sphingoid chebi_ontology cationic sphingoids sphingoid cation sphingoid cations CHEBI:83876 cationic sphingoid cationic sphingoids chebi sphingoid cation chebi sphingoid cations chebi Any alpha-amino acid which is not a member of the group of 23 proteinogenic amino acids. Any α-amino acid which is not a member of the group of 23 proteinogenic amino acids. chebi_ontology non-proteinogenic alpha-amino acids non-proteinogenic alpha-amino-acid non-proteinogenic alpha-amino-acids CHEBI:83925 non-proteinogenic alpha-amino acid non-proteinogenic alpha-amino acids ChEBI non-proteinogenic alpha-amino acids chebi non-proteinogenic alpha-amino-acid ChEBI non-proteinogenic alpha-amino-acid chebi non-proteinogenic alpha-amino-acids ChEBI non-proteinogenic alpha-amino-acids chebi A proteinogenic amino acid derivative resulting from reaction of <small>L</small>-aspartic acid at the amino group or either of the carboxy groups, or from the replacement of any hydrogen of <small>L</small>-aspartic acid by a heteroatom. chebi_ontology L-aspartic acid derivatives CHEBI:83978 L-aspartic acid derivative L-aspartic acid derivatives chebi A proteinogenic amino acid derivative resulting from reaction of <small>L</small>-glutamic acid at the amino group or either of the carboxy groups, or from the replacement of any hydrogen of <small>L</small>-glutamic acid by a heteroatom. chebi_ontology L-glutamic acid derivatives CHEBI:83982 L-glutamic acid derivative L-glutamic acid derivatives chebi Any phospho sugar that is the phosphate derivative of pentose. chebi_ontology pentose phosphates CHEBI:84055 pentose phosphate pentose phosphates ChEBI pentose phosphates chebi Any metabolite (endogenous or exogenous) found in human urine samples. chebi_ontology human urinary metabolites CHEBI:84087 human urinary metabolite human urinary metabolites ChEBI human urinary metabolites chebi A non-proteinogenic amino acid derivative resulting from reaction of D-tyrosine at the amino group or the carboxy group, or from the replacement of any hydrogen of D-tyrosine by a heteroatom. D-tyrosine derivatives CHEBI:84124 D-tyrosine derivative D-tyrosine derivatives ChEBI A non-proteinogenic amino acid derivative resulting from reaction of D-phenylalanine at the amino group or the carboxy group, or from the replacement of any hydrogen of D-phenylalanine by a heteroatom. D-phenylalanine derivatives CHEBI:84143 D-phenylalanine derivative D-phenylalanine derivatives ChEBI A proteinogenic amino acid derivative resulting from reaction of L-phenylalanine at the amino group or the carboxy group, or from the replacement of any hydrogen of L-phenylalanine by a heteroatom. L-phenylalanine derivatives CHEBI:84144 L-phenylalanine derivative L-phenylalanine derivatives ChEBI A prephenic acid having (1s,4s)-cis-configuration. KEGG:C00254 MetaCyc:PREPHENATE Wikipedia:Prephenic_acid Prephenic acid, cis cis-1-Carboxy-4-hydroxy-alpha-oxo-2,5-cyclohexadiene-1-propanoic acid cis-prephenic acid CHEBI:84387 (1s,4s)-prephenic acid Prephenic acid, cis ChemIDplus cis-1-Carboxy-4-hydroxy-alpha-oxo-2,5-cyclohexadiene-1-propanoic acid ChemIDplus cis-prephenic acid ChEBI A cationic sphingoid obtained by protonation of the amino group of any 2-amino-1,3-dihydroxysphingoid base. chebi_ontology 2-amino-1,3-dihydroxysphingoid base(1+) a sphingoid base CHEBI:84410 sphingoid base(1+) 2-amino-1,3-dihydroxysphingoid base(1+) chebi a sphingoid base uniprot_ft Any member of the class of indoles carrying at least one hydroxy group. chebi_ontology CHEBI:84729 hydroxyindoles Any eukaryotic metabolite produced during a metabolic reaction in algae including unicellular organisms like chlorella and diatoms to multicellular organisms like giant kelps and brown algae. chebi_ontology algal metabolites CHEBI:84735 algal metabolite algal metabolites ChEBI algal metabolites chebi A carbocyclic fatty acid composed of heptanoic acid having a (1<i>S</i>,2<i>S</i>)-2-octylcyclopentyl substituent at position 7. chebi_ontology Prostanoic acid CHEBI:8504 prostanoic acid Prostanoic acid kegg.compound Any cosmetic used to lighten the colour of skin by reducing the concentration of melanin. chebi_ontology melanogenesis inhibitor melanogenesis inhibitors skin bleaching agent skin bleaching agents skin depigmenting agent skin depigmenting agents skin lightening agents skin whitening agent skin whitening agents CHEBI:85046 skin lightening agent melanogenesis inhibitor chebi melanogenesis inhibitors chebi skin bleaching agent chebi skin bleaching agents chebi skin depigmenting agent chebi skin depigmenting agents chebi skin lightening agents chebi skin whitening agent chebi skin whitening agents chebi Any metabolite (endogenous or exogenous) found in human blood serum samples. chebi_ontology human blood serum metabolites CHEBI:85234 human blood serum metabolite human blood serum metabolites chebi A 17β-hydroxy steroid that is testosterone in which the 4-5 double bond has been reduced to a single bond with unspecified configuration at position 5. chebi_ontology 17beta-hydroxyandrostanone dihydrotestosterone CHEBI:85278 17beta-hydroxyandrostan-3-one 17beta-hydroxyandrostanone uniprot_ft dihydrotestosterone submitter An <em>N</em>-acylethanolamine resulting from the formal condensation of the carboxy group of any polyunsaturated fatty acid with the amino group of ethanolamine. chebi_ontology N-polyunsaturated fatty acyl-ethanolamine polyunsaturated fatty acid 2-hydroxyethylamide polyunsaturated fatty acid 2-hydroxyethylamides polyunsaturated fatty acyl ethanolamide polyunsaturated fatty acyl ethanolamide s CHEBI:85281 N-(polyunsaturated fatty acyl)ethanolamine N-polyunsaturated fatty acyl-ethanolamine chebi polyunsaturated fatty acid 2-hydroxyethylamide chebi polyunsaturated fatty acid 2-hydroxyethylamides chebi polyunsaturated fatty acyl ethanolamide chebi polyunsaturated fatty acyl ethanolamide s chebi Any mammalian metabolite produced during a metabolic reaction in rat (<em>Rattus norvegicus</em>). chebi_ontology Rattus norvegicus metabolite Rattus norvegicus metabolites rat metabolites CHEBI:86264 rat metabolite Rattus norvegicus metabolite chebi Rattus norvegicus metabolites chebi rat metabolites chebi Any antifungal agent used to prevent or treat fungal infections in humans or animals. Wikipedia:Antifungal chebi_ontology anti-fungal drug anti-fungal drugs anti-fungal medication anti-fungal medications antifungal drugs antifungal medication antifungal medications pharmaceutical fungicide pharmaceutical fungicides CHEBI:86327 antifungal drug anti-fungal drug ChEBI anti-fungal drug chebi anti-fungal drugs ChEBI anti-fungal drugs chebi anti-fungal medication ChEBI anti-fungal medication chebi anti-fungal medications ChEBI anti-fungal medications chebi antifungal drugs ChEBI antifungal drugs chebi antifungal medication ChEBI antifungal medication chebi antifungal medications ChEBI antifungal medications chebi pharmaceutical fungicide ChEBI pharmaceutical fungicide chebi pharmaceutical fungicides ChEBI pharmaceutical fungicides chebi An organophosphate oxoanion obtained by deprotonation of two of the three diphosphate OH groups of adenosine 5'-diphosphate. chebi_ontology CHEBI:87518 ADP(2-) Any metal which causes the onset of an allergic reaction. chebi_ontology allergenic metal allergenic metals metal allergens CHEBI:88184 metal allergen allergenic metal chebi allergenic metals chebi metal allergens chebi A drug that acts as an antagonist, agonist, reverse agonist, or in some other fashion when interacting with cellular receptors. CHEBI:189678 Wikipedia:Receptor_modulator chebi_ontology receptor modulators CHEBI:90710 receptor modulator receptor modulators ChEBI receptor modulators chebi A carboxylic acic anion obtained by deprotonation of the carboxy group of any aromatic carboxylic acid. Major species at pH 7.3. chebi_ontology an aromatic carboxylate CHEBI:91007 aromatic carboxylate an aromatic carboxylate uniprot_ft chebi_ontology (5R,9R,13S)-4,5-epoxy-3,6-dimethoxy-9alpha-methyl-6,8-morphinadien (5alpha)-6,7,8,14-tetradehydro-4,5-epoxy-3,6-dimethoxy-17-methylmorphinan 3-O-methyl-oripavin 4,5alpha-epoxy-3,6-dimethoxy-17-methyl-6,8-morphinadien Thebaine paramorphine CHEBI:9519 thebaine (5R,9R,13S)-4,5-epoxy-3,6-dimethoxy-9alpha-methyl-6,8-morphinadien chemidplus (5alpha)-6,7,8,14-tetradehydro-4,5-epoxy-3,6-dimethoxy-17-methylmorphinan nist 3-O-methyl-oripavin chemidplus 4,5alpha-epoxy-3,6-dimethoxy-17-methyl-6,8-morphinadien chemidplus Thebaine kegg.compound paramorphine chemidplus A family of cyclic nonapeptide hormones found in most mammals. Synthesised in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Together with the similar neuropeptide oxytocin, they are believed to influence social cognition and behaviour. A family of cyclic nonapeptide hormones found in most mammals. Synthesised in the hypothalamus and stored in the post-pituitary, vasopressins play a key rôle in homeostasis, particularly in regulating the body's water content. Together with the similar neuropeptide oxytocin, they are believed to influence social cognition and behaviour. KEGG:C00840 KEGG:D00101 Vasopressin chebi_ontology ADH AVP Antidiuretic hormone VP Vasopressin arginine vasopressin argipressin beta-Hypophamine CHEBI:9937 vasopressin Vasopressin KEGG_COMPOUND ADH KEGG_COMPOUND ADH kegg.compound AVP ChEBI AVP chebi Antidiuretic hormone KEGG_COMPOUND Antidiuretic hormone kegg.compound VP KEGG_COMPOUND VP kegg.compound Vasopressin kegg.compound arginine vasopressin ChEBI arginine vasopressin chebi argipressin ChEBI argipressin chebi beta-Hypophamine ChemIDplus beta-Hypophamine chemidplus A material entity of anatomical origin (part of or deriving from an organism) that has as its parts a maximally connected cell compartment surrounded by a plasma membrane. CALOHA:TS-2035 FMA:68646 GO:0005623 KUPO:0000002 MESH:D002477 VHOG:0001533 WBbt:0004017 XAO:0003012 The definition of cell is intended to represent all cells, and thus a cell is defined as a material entity and not an anatomical structure, which implies that it is part of an organism (or the entirety of one). cell A material entity of anatomical origin (part of or deriving from an organism) that has as its parts a maximally connected cell compartment surrounded by a plasma membrane. CARO:mah Any fibroblast that is derived from the neural crest. fibroblast neural crest derived neural crest derived fibroblast Any fibroblast that is derived from the neural crest. https://orcid.org/0000-0001-5208-3432 Any sensory receptor cell that is a(n) neuron and is capable of some detection of stimulus involved in sensory perception. neuronal receptor cell (sensu Animalia) neuronal receptor cell Any sensory receptor cell that is a(n) neuron and is capable of some detection of stimulus involved in sensory perception. FBC:Autogenerated A cell found in the embryo before the formation of all the gem layers is complete. early embryonic cell (metazoa) A cell found in the embryo before the formation of all the gem layers is complete. GOC:tfm Cell that is part of the migratory cranial neural crest population. Migratory cranial neural crest cells develop from premigratory cranial neural crest cells and have undergone epithelial to mesenchymal transition and delamination. migratory cranial neural crest cell Cell that is part of the migratory cranial neural crest population. Migratory cranial neural crest cells develop from premigratory cranial neural crest cells and have undergone epithelial to mesenchymal transition and delamination. ZFA:0007091 https://orcid.org/0000-0001-5208-3432 Cell that is part of the migratory trunk neural crest population. Migratory trunk neural crest cells develop from premigratory trunk neural crest cells and have undergone epithelial to mesenchymal transition and delamination. migratory trunk neural crest cell Cell that is part of the migratory trunk neural crest population. Migratory trunk neural crest cells develop from premigratory trunk neural crest cells and have undergone epithelial to mesenchymal transition and delamination. ZFA:0007095 https://orcid.org/0000-0001-5208-3432 A stem cell that is the precursor of gametes. germline stem cell germ line stem cell A stem cell that is the precursor of gametes. doi:10.1016/j.stem.2012.05.016 A germ cell that supports male gamete production. In some species, non-germ cells known as Sertoli cells also play a role in spermatogenesis. FMA:72290 MA:0002765 VHOG:0001531 ncithesaurus:Spermatogenic_Cell male germ cell A germ cell that supports male gamete production. In some species, non-germ cells known as Sertoli cells also play a role in spermatogenesis. PMID:29462262 https://orcid.org/0000-0001-5208-3432 A male germ cell that develops from spermatogonia. The euploid primary spermatocytes undergo meiosis and give rise to the haploid secondary spermatocytes which in turn give rise to spermatids. BTO:0001275 CALOHA:TS-0951 EMAPA:31484 FMA:84049 WBbt:0006799 spermatocyte A male germ cell that develops from spermatogonia. The euploid primary spermatocytes undergo meiosis and give rise to the haploid secondary spermatocytes which in turn give rise to spermatids. GOC:tfm MESH:D013090