About   Help   FAQ
Antibody
Detail
Antibody
Name: Syde1 antibody
Host: rabbit
Type: Polyclonal
Note: This antibody was obtained from Sigma-Aldrich (HPA013328).
MGI Accession ID: MGI:6154890
Antigen
Name: SYDE-1
Species: human
Note: GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILDLERELSKQINV
Gene Syde1  synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
Expression Gene Expression Data (11 results)
Reference J:241798 Lo HF, et al., J Pathol. 2017 Feb;241(3):324-336

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer & Copyright Notice
Send questions and comments to User Support.
last database update
11/23/2021
MGI 6.17
The Jackson Laboratory