About   Help   FAQ
Antibody
Detail
Antibody
Name: anti-ARID1B (MO1, clone 2D2) (H00057492-M02)
Host: mouse
Type: Monoclonal
Class: Not Specified
Note: This antibody was obtained from Abnova (H00057492-M02).
MGI Accession ID: MGI:6515741
Antigen
Name: ARID1B
Species: human
Region covered: amino acids 1364-1460
Note: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Gene Arid1b  AT rich interactive domain 1B (SWI-like)
Expression Gene Expression Data (2 results)
Reference J:175568 Flores-Alcantar A, et al., Cell Tissue Res. 2011 Jul;345(1):137-48

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer & Copyright Notice
Send questions and comments to User Support.
last database update
08/03/2022
MGI 6.21
The Jackson Laboratory