About   Help   FAQ
Antibody
Detail
Antibody
Name: Anti-Connexin 30.1/Gjb5 NBP1-84333
Host: rabbit
Type: Polyclonal
Note: This antibody was obtained from Novus Biologicals. The antibody was affinity purified.
MGI Accession ID: MGI:6202585
Antigen
Name: Connexin 30.1/Gjb5
Species: Not Specified
Region covered: amino acids: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
Gene Gjb5  gap junction protein, beta 5
Expression Gene Expression Data (2 results)
Reference J:264256 Bernardo AS, et al., Biol Open. 2018 Aug 17;7(8):bio033282

Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer & Copyright Notice
Send questions and comments to User Support.
last database update
05/10/2022
MGI 6.19
The Jackson Laboratory